F274665

General Info

Members Datasets Scaffolds Average Seq Length
179 151 156 404

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2599185156|2599334677
Length 436
Sequence ENASLTTEPWLTIVGLGEDGLAGLGEEAKQAISNARLVFGGTRHLALAAPLITGESCPWSSPFETAIDVVVAMAGMPVVVLASGDPFFFGVGVTLSRRIDPSQMRVLPAPSAFSLAAARLGWALQDVVCLSLHGRPLDLLRPHLHGGTRILALTSDGEGPAAVAALMRDTGFGASAFTVLEAMGGPQERISFHTANGFDLAACHSLNVCAIEVVAGQQARVLGLTPGLDDDLFEHDGQITKREVRALTLSALSPRRGECLWDIGAGAGSIAIEWMLADPSLRAVAIEAHPERAARIGRNARAFGVPELRIVEGVVPHALADLGREPRPDAIFVGGGGSEAGVMDAALDALRPGGRLVANAVTTEMEAVLLASRAAHGGSLTRIDIARASPVGAMTGWRPAMPVTQWVWIKPALTGPDDVSEDDMGIDVGKTRGELA

Samples

Sample ID Description Type Environment
1 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
2 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
3 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
4 2643221557 Ensifer sp. Root558 Isolate Unclassified
5 2643221607 Rhizobium sp. Root73 Isolate Unclassified
6 2643221610 Ensifer sp. Root74 Isolate Unclassified
7 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
8 2643221668 Ensifer sp. Root423 Isolate Unclassified
9 2643221675 Ensifer sp. Root1298 Isolate Unclassified
10 2643221680 Ensifer sp. Root1312 Isolate Unclassified
11 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
12 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
13 2643221723 Ensifer sp. Root278 Isolate Unclassified
14 2643221726 Ensifer sp. Root954 Isolate Unclassified
15 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
16 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
17 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
18 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
19 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
20 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
21 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
22 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
23 2996887358 Rhizobium sp. R711 Isolate Nodule
24 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
25 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
26 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
27 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
28 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
29 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
66 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
89 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
98 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
99 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
100 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
101 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
102 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
103 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
104 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
105 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
106 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
107 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
108 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
109 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
110 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
111 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
112 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
113 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
114 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
115 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
116 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
117 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
118 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
119 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
120 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
121 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
122 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
123 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
124 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
125 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
126 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
127 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
128 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
129 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
130 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
137 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
138 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
139 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
140 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
145 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
146 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
147 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
148 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
149 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
150 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
151 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.15
Metatranscriptomes 0
Isolates 12.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.2
Nodule 1.12
Rhizoplane 3.35
Rhizosphere 55.31
Stem 0
Stem Tuber 0
Unclassified 24.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000092 3300002987 Bacteria 42762
2 JGI25159J45721_1000403 3300002987 Bacteria 20187
3 rootH1_10051438 3300003316 Bacteria 4835
4 JGI25160J50197_1000134 3300003354 Bacteria 66627
5 JGI25161J50226_1000116 3300003374 Bacteria 62089
6 Ga0055526_1002223 3300003771 Bacteria 13288
7 Ga0055524_1001125 3300003775 Bacteria 16106
8 Ga0055524_1003343 3300003775 Bacteria 7820
9 Ga0065165_1000196 3300005262 Bacteria 104569
10 Ga0065707_10082198 3300005295 Bacteria 19357
11 Ga0070670_100000196 3300005331 Bacteria 56006
12 Ga0070689_100000836 3300005340 Bacteria 19082
13 Ga0070675_100059625 3300005354 Bacteria 3149
14 Ga0070671_100018992 3300005355 Bacteria 5591
15 Ga0070688_100019620 3300005365 Bacteria 3919
16 Ga0070667_100059710 3300005367 Bacteria 3226
17 Ga0070667_100173435 3300005367 Bacteria 1905
18 Ga0070714_100072189 3300005435 Bacteria 2987
19 Ga0070711_100067110 3300005439 Bacteria 2516
20 Ga0070694_100206969 3300005444 Bacteria 1465
21 Ga0070681_10006541 3300005458 Bacteria 11347
22 Ga0070706_100234218 3300005467 Bacteria 1714
23 Ga0070707_100040444 3300005468 Bacteria 4461
24 Ga0070665_100031307 3300005548 Bacteria 5354
25 Ga0070665_100133010 3300005548 Bacteria 2489
26 Ga0068859_100003663 3300005617 Bacteria 15658
27 Ga0068863_100014040 3300005841 Bacteria 7717
28 Ga0068858_100000887 3300005842 Bacteria 31036
29 Ga0068860_100000498 3300005843 Bacteria 48732
30 Ga0081539_10049131 3300005985 Bacteria 2396
31 Ga0075365_10024074 3300006038 Bacteria 3836
32 Ga0075362_10023076 3300006177 Bacteria 2628
33 Ga0075362_10023530 3300006177 Bacteria 2606
34 Ga0075430_100039096 3300006846 Bacteria 4018
35 Ga0075433_10244784 3300006852 Bacteria 1592
36 Ga0068865_100040946 3300006881 Bacteria 3151
37 Ga0097620_100003663 3300006931 Bacteria 15658
38 Ga0105240_10158328 3300009093 Bacteria 2692
39 Ga0105240_10188614 3300009093 Bacteria 2426
40 Ga0105248_10088818 3300009177 Bacteria 3479
41 Ga0105237_10334105 3300009545 Bacteria 1520
42 Ga0105249_10232769 3300009553 Bacteria 1818
43 Ga0105249_10379712 3300009553 Bacteria 1439
44 Ga0105239_10147424 3300010375 Unclassified 2626
45 Ga0171463_1014 3300013249 Bacteria 83917
46 Ga0163163_10113852 3300014325 Bacteria 2735
47 Ga0183363_1028 3300015690 Bacteria 50706
48 Ga0213876_10026846 3300021384 Bacteria 3038
49 Ga0209129_1001926 3300025258 Bacteria 10892
50 Ga0209130_1000198 3300025284 Bacteria 82557
51 Ga0209676_1003330 3300025292 Bacteria 10036
52 Ga0209025_1000339 3300025294 Bacteria 103239
53 Ga0209025_1016670 3300025294 Bacteria 4309
54 Ga0209564_1000353 3300025295 Bacteria 85747
55 Ga0209050_1000299 3300025298 Bacteria 104017
56 Ga0209050_1004839 3300025298 Bacteria 8838
57 Ga0209256_1000368 3300025299 Bacteria 72598
58 Ga0209256_1000456 3300025299 Bacteria 61717
59 Ga0209256_1000884 3300025299 Bacteria 37000
60 Ga0207426_1000048 3300025302 Bacteria 409127
61 Ga0209051_1001164 3300025303 Bacteria 23925
62 Ga0209257_1002967 3300025304 Bacteria 15506
63 Ga0207699_10175068 3300025906 Bacteria 1438
64 Ga0207645_10019218 3300025907 Bacteria 4482
65 Ga0207695_10131623 3300025913 Bacteria 2459
66 Ga0207693_10124700 3300025915 Bacteria 2024
67 Ga0207652_10051751 3300025921 Bacteria 3522
68 Ga0207646_10026247 3300025922 Bacteria 5318
69 Ga0207646_10209741 3300025922 Bacteria 1759
70 Ga0207650_10000347 3300025925 Bacteria 44769
71 Ga0207670_10000845 3300025936 Bacteria 16075
72 Ga0207703_10002684 3300026035 Bacteria 15262
73 Ga0207641_10000337 3300026088 Bacteria 57031
74 Ga0207683_10083228 3300026121 Bacteria 2843
75 Ga0268266_10050410 3300028379 Bacteria 3571
76 Ga0268264_10000375 3300028381 Bacteria 65683
77 Ga0307510_10000001 3300033180 Bacteria 1172244
78 Ga0307510_10024370 3300033180 Bacteria 6992
79 Ga0373923_0057486 3300035111 Bacteria 1645
80 Ga0373947_0111746 3300035725 Bacteria 1727
81 Ga0373937_0065504 3300036401 Bacteria 3345
82 Ga0395899_0030139 3300037312 Bacteria 4081
83 Ga0395900_0017386 3300037418 Bacteria 7340
84 Ga0395898_0087076 3300037466 Bacteria 3009
85 Ga0395901_0045113 3300038443 Bacteria 4573
86 Ga0436365_0813916 3300039437 Bacteria 7986
87 Ga0436365_0929432 3300039437 Bacteria 1599
88 Ga0436365_1707801 3300039437 Bacteria 13214
89 Ga0439438_033564 3300041405 Bacteria 1355
90 Ga0439464_0031652 3300042439 Bacteria 1485
91 Ga0466966_0016179 3300044684 Bacteria 4932
92 Ga0466961_0012174 3300044693 Bacteria 5501
93 Ga0466968_0006414 3300044735 Bacteria 4436
94 Ga0466968_0020015 3300044735 Bacteria 2697
95 Ga0466958_0008848 3300045836 Bacteria 5595
96 Ga0495629_0027078 3300046459 Bacteria 4072
97 Ga0495638_0002563 3300046460 Bacteria 14720
98 Ga0495651_0057813 3300046462 Bacteria 2977
99 Ga0495650_0041196 3300046471 Bacteria 1977
100 Ga0495606_0054981 3300046507 Bacteria 2576
101 Ga0495610_0000285 3300046512 Bacteria 52902
102 Ga0495643_0019538 3300046522 Bacteria 3917
103 Ga0495622_0037491 3300046557 Bacteria 2258
104 Ga0495625_0000420 3300046660 Bacteria 63775
105 Ga0495604_0030377 3300047317 Bacteria 4291
106 Ga0495604_0067073 3300047317 Bacteria 2727
107 Ga0495687_032684 3300047443 Bacteria 2371
108 Ga0495686_0002492 3300047472 Bacteria 17303
109 Ga0496102_0042839 3300048905 Bacteria 4103
110 Ga0496109_0034719 3300048912 Bacteria 4545
111 Ga0496110_0062307 3300048913 Bacteria 3294
112 Ga0496115_0120925 3300048918 Bacteria 2155
113 Ga0496116_0000060 3300048919 Bacteria 272219
114 Ga0496116_0063130 3300048919 Bacteria 2387
115 Ga0496117_0001061 3300048920 Bacteria 41887
116 Ga0496118_0000040 3300048921 Bacteria 304516
117 Ga0496118_0049104 3300048921 Bacteria 3252
118 Ga0496119_0001116 3300048922 Bacteria 33850
119 Ga0496119_0012808 3300048922 Bacteria 6766
120 Ga0496120_0000104 3300048923 Bacteria 140731
121 Ga0496121_0001779 3300048924 Bacteria 34950
122 Ga0496121_0053585 3300048924 Bacteria 3378
123 Ga0496122_0001106 3300048925 Bacteria 46592
124 Ga0496123_0000457 3300048926 Bacteria 71921
125 Ga0496124_0002877 3300048927 Bacteria 21757
126 Ga0496124_0007980 3300048927 Bacteria 11142
127 Ga0496124_0011273 3300048927 Bacteria 8948
128 Ga0496124_0082859 3300048927 Bacteria 2632
129 Ga0496125_0000424 3300048928 Bacteria 78587
130 Ga0496125_0004802 3300048928 Bacteria 15372
131 Ga0496125_0017253 3300048928 Bacteria 6896
132 Ga0496125_0162554 3300048928 Bacteria 1514
133 Ga0496126_0002193 3300048929 Bacteria 27133
134 Ga0501033_0090520 3300049570 Bacteria 2238
135 Ga0501036_0156836 3300049572 Bacteria 1920
136 Ga0501039_0043034 3300049575 Bacteria 3489
137 Ga0501040_0074894 3300049576 Bacteria 2339
138 Ga0501042_0035794 3300049578 Bacteria 3522
139 Ga0501043_0036012 3300049579 Bacteria 3892
140 Ga0501070_0056841 3300049586 Bacteria 3244
141 Ga0501071_0076324 3300049587 Bacteria 2447
142 Ga0501075_0029010 3300049591 Bacteria 4090
143 Ga0501076_0038613 3300049592 Bacteria 3749
144 Ga0501077_0004436 3300049593 Bacteria 8522
145 Ga0501079_0099928 3300049741 Bacteria 2249
146 Ga0501079_0157650 3300049741 Bacteria 1769
147 Ga0501080_0054371 3300049742 Bacteria 3728
148 Ga0501035_0079713 3300049822 Bacteria 2892
149 nmdc:mga03683_34878_c1 3300050489 Bacteria 2038
150 nmdc:mga0yw44_4675_c1 3300050492 Bacteria 6328
151 nmdc:mga0qj67_11312_c1 3300050509 Bacteria 6685
152 Ga0495601_0041000 3300053077 Bacteria 2901
153 Ga0500618_000146 3300053125 Bacteria 58637
154 Ga0500634_0002843 3300053161 Bacteria 7476
155 Ga0501084_0022998 3300054114 Bacteria 5203
156 Ga0530510_0011130 3300061734 Bacteria 6310

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2818991438 2819552051 339
2 3300048912 Ga0496109_0034719 Ga0496109_0034719_3500_4528 342
3 3300048927 Ga0496124_0082859 Ga0496124_0082859_1578_2609 343
4 3300035111 Ga0373923_0057486 Ga0373923_0057486_11_1072 353
5 3300025294 Ga0209025_1016670 Ga0209025_10166702 359
6 3300025298 Ga0209050_1000299 Ga0209050_100029944 365
7 3300037312 Ga0395899_0030139 Ga0395899_0030139_856_2094 370
8 3300037418 Ga0395900_0017386 Ga0395900_0017386_2620_3858 370
9 3300037466 Ga0395898_0087076 Ga0395898_0087076_1240_2478 370
10 3300038443 Ga0395901_0045113 Ga0395901_0045113_1988_3226 370
11 3300005331 Ga0070670_100000196 Ga0070670_10000019633 372
12 3300005340 Ga0070689_100000836 Ga0070689_1000008369 372
13 3300005355 Ga0070671_100018992 Ga0070671_1000189923 372
14 3300005365 Ga0070688_100019620 Ga0070688_1000196203 372
15 3300006881 Ga0068865_100040946 Ga0068865_1000409463 372
16 3300025925 Ga0207650_10000347 Ga0207650_1000034727 372
17 3300025936 Ga0207670_10000845 Ga0207670_100008459 372
18 3300049570 Ga0501033_0090520 Ga0501033_0090520_905_2167 373
19 3300046459 Ga0495629_0027078 Ga0495629_0027078_2868_4019 378
20 3300039437 Ga0436365_0813916 Ga0436365_0813916_6572_7735 382
21 3300048922 Ga0496119_0012808 Ga0496119_0012808_717_1877 382
22 3300048924 Ga0496121_0053585 Ga0496121_0053585_1693_2853 382
23 3300048928 Ga0496125_0004802 Ga0496125_0004802_4031_5191 382
24 3300049579 Ga0501043_0036012 Ga0501043_0036012_1241_2503 382
25 3300049572 Ga0501036_0156836 Ga0501036_0156836_479_1741 383
26 3300021384 Ga0213876_10026846 Ga0213876_100268462 385
27 3300039437 Ga0436365_1707801 Ga0436365_1707801_9955_11127 385
28 3300044735 Ga0466968_0020015 Ga0466968_0020015_819_2066 386
29 3300044684 Ga0466966_0016179 Ga0466966_0016179_2598_3776 387
30 3300044693 Ga0466961_0012174 Ga0466961_0012174_1437_2615 387
31 3300044735 Ga0466968_0006414 Ga0466968_0006414_1540_2718 387
32 3300045836 Ga0466958_0008848 Ga0466958_0008848_1670_2848 387
33 iso_pu_bacteria 2919679072 2919682019 387
34 3300053077 Ga0495601_0041000 Ga0495601_0041000_124_1383 388
35 3300046512 Ga0495610_0000285 Ga0495610_0000285_24720_25943 391
36 3300046522 Ga0495643_0019538 Ga0495643_0019538_525_1748 391
37 3300047472 Ga0495686_0002492 Ga0495686_0002492_12097_13320 391
38 3300049578 Ga0501042_0035794 Ga0501042_0035794_644_1885 392
39 3300049586 Ga0501070_0056841 Ga0501070_0056841_1559_2800 392
40 3300049587 Ga0501071_0076324 Ga0501071_0076324_515_1756 392
41 3300049591 Ga0501075_0029010 Ga0501075_0029010_1592_2833 392
42 3300049593 Ga0501077_0004436 Ga0501077_0004436_6787_8028 392
43 3300049741 Ga0501079_0099928 Ga0501079_0099928_326_1567 392
44 3300049742 Ga0501080_0054371 Ga0501080_0054371_1308_2549 392
45 3300049822 Ga0501035_0079713 Ga0501035_0079713_119_1360 392
46 3300054114 Ga0501084_0022998 Ga0501084_0022998_2164_3405 392
47 3300061734 Ga0530510_0011130 Ga0530510_0011130_2219_3460 392
48 3300047317 Ga0495604_0030377 Ga0495604_0030377_2475_3659 393
49 3300003316 rootH1_10051438 rootH1_100514384 395
50 3300005548 Ga0070665_100031307 Ga0070665_1000313076 395
51 3300009093 Ga0105240_10158328 Ga0105240_101583283 395
52 3300028379 Ga0268266_10050410 Ga0268266_100504102 395
53 3300033180 Ga0307510_10000001 Ga0307510_10000001844 395
54 3300048922 Ga0496119_0001116 Ga0496119_0001116_9643_10842 395
55 3300048923 Ga0496120_0000104 Ga0496120_0000104_64881_66080 395
56 iso_pu_bacteria 2808606384 2808971005 396
57 iso_pu_bacteria 2808606390 2809006092 396
58 iso_pu_bacteria 2808606391 2809012972 396
59 3300050509 nmdc:mga0qj67_11312_c1 nmdc:mga0qj67_11312_c1_2093_3301 398
60 3300005295 Ga0065707_10082198 Ga0065707_100821984 399
61 3300005367 Ga0070667_100173435 Ga0070667_1001734352 400
62 3300025907 Ga0207645_10019218 Ga0207645_100192183 400
63 3300025922 Ga0207646_10209741 Ga0207646_102097412 400
64 3300042439 Ga0439464_0031652 Ga0439464_0031652_112_1314 400
65 3300005444 Ga0070694_100206969 Ga0070694_1002069691 401
66 3300005468 Ga0070707_100040444 Ga0070707_1000404443 401
67 3300006852 Ga0075433_10244784 Ga0075433_102447842 401
68 3300009553 Ga0105249_10379712 Ga0105249_103797122 401
69 3300025922 Ga0207646_10026247 Ga0207646_100262474 401
70 3300048913 Ga0496110_0062307 Ga0496110_0062307_561_1766 401
71 3300048919 Ga0496116_0000060 Ga0496116_0000060_63793_64998 401
72 3300048921 Ga0496118_0049104 Ga0496118_0049104_270_1475 401
73 3300048924 Ga0496121_0001779 Ga0496121_0001779_14282_15487 401
74 3300048925 Ga0496122_0001106 Ga0496122_0001106_4412_5617 401
75 3300048926 Ga0496123_0000457 Ga0496123_0000457_44389_45594 401
76 3300048927 Ga0496124_0002877 Ga0496124_0002877_8003_9208 401
77 3300048927 Ga0496124_0007980 Ga0496124_0007980_3074_4279 401
78 3300048928 Ga0496125_0017253 Ga0496125_0017253_2517_3722 401
79 3300048929 Ga0496126_0002193 Ga0496126_0002193_24177_25406 401
80 3300049576 Ga0501040_0074894 Ga0501040_0074894_624_1844 406
81 3300049741 Ga0501079_0157650 Ga0501079_0157650_327_1547 406
82 iso_pu_bacteria 2512047086 2512534330 406
83 iso_pu_bacteria 2996887358 2996891353 406
84 3300005367 Ga0070667_100059710 Ga0070667_1000597103 407
85 3300005548 Ga0070665_100133010 Ga0070665_1001330103 407
86 3300005617 Ga0068859_100003663 Ga0068859_10000366313 407
87 3300005841 Ga0068863_100014040 Ga0068863_1000140402 407
88 3300005842 Ga0068858_100000887 Ga0068858_10000088725 407
89 3300005843 Ga0068860_100000498 Ga0068860_10000049817 407
90 3300006931 Ga0097620_100003663 Ga0097620_1000036633 407
91 3300009093 Ga0105240_10188614 Ga0105240_101886142 407
92 3300009553 Ga0105249_10232769 Ga0105249_102327692 407
93 3300010375 Ga0105239_10147424 Ga0105239_101474243 407
94 3300014325 Ga0163163_10113852 Ga0163163_101138523 407
95 3300025906 Ga0207699_10175068 Ga0207699_101750681 407
96 3300025913 Ga0207695_10131623 Ga0207695_101316232 407
97 3300025915 Ga0207693_10124700 Ga0207693_101247002 407
98 3300026035 Ga0207703_10002684 Ga0207703_1000268413 407
99 3300026088 Ga0207641_10000337 Ga0207641_1000033721 407
100 3300028381 Ga0268264_10000375 Ga0268264_100003756 407
101 3300033180 Ga0307510_10024370 Ga0307510_100243708 407
102 3300046507 Ga0495606_0054981 Ga0495606_0054981_1031_2278 407
103 3300048905 Ga0496102_0042839 Ga0496102_0042839_2416_3663 407
104 3300048918 Ga0496115_0120925 Ga0496115_0120925_685_1932 407
105 3300048919 Ga0496116_0063130 Ga0496116_0063130_398_1645 407
106 3300048920 Ga0496117_0001061 Ga0496117_0001061_21598_22845 407
107 3300048921 Ga0496118_0000040 Ga0496118_0000040_21600_22847 407
108 3300048928 Ga0496125_0000424 Ga0496125_0000424_26346_27593 407
109 iso_pu_bacteria 2599185156 2599334677 408
110 iso_pu_bacteria 2842922631 2842925801 408
111 3300005467 Ga0070706_100234218 Ga0070706_1002342182 409
112 3300006038 Ga0075365_10024074 Ga0075365_100240742 409
113 3300025303 Ga0209051_1001164 Ga0209051_100116418 409
114 3300049575 Ga0501039_0043034 Ga0501039_0043034_2214_3467 409
115 3300049592 Ga0501076_0038613 Ga0501076_0038613_1256_2497 409
116 3300050492 nmdc:mga0yw44_4675_c1 nmdc:mga0yw44_4675_c1_2518_3759 409
117 iso_pu_bacteria 2599185352 2600194174 409
118 iso_pu_bacteria 2643221557 2643809685 409
119 iso_pu_bacteria 2643221610 2644063865 409
120 iso_pu_bacteria 2643221668 2644381387 409
121 iso_pu_bacteria 2643221675 2644415698 409
122 iso_pu_bacteria 2643221680 2644448738 409
123 iso_pu_bacteria 2643221689 2644500111 409
124 iso_pu_bacteria 2643221723 2644676659 409
125 iso_pu_bacteria 2643221726 2644686868 409
126 iso_pu_bacteria 2920822456 2920828402 409
127 iso_pu_bacteria 2941499720 2941501609 409
128 3300009177 Ga0105248_10088818 Ga0105248_100888183 410
129 3300009545 Ga0105237_10334105 Ga0105237_103341051 410
130 3300025258 Ga0209129_1001926 Ga0209129_10019269 410
131 3300046462 Ga0495651_0057813 Ga0495651_0057813_902_2149 410
132 3300046471 Ga0495650_0041196 Ga0495650_0041196_645_1877 410
133 3300046557 Ga0495622_0037491 Ga0495622_0037491_605_1852 410
134 3300047317 Ga0495604_0067073 Ga0495604_0067073_626_1873 410
135 3300048927 Ga0496124_0011273 Ga0496124_0011273_5926_7158 410
136 3300005354 Ga0070675_100059625 Ga0070675_1000596252 411
137 3300005435 Ga0070714_100072189 Ga0070714_1000721893 411
138 3300005439 Ga0070711_100067110 Ga0070711_1000671103 411
139 3300005458 Ga0070681_10006541 Ga0070681_100065414 411
140 3300006177 Ga0075362_10023076 Ga0075362_100230762 411
141 3300006177 Ga0075362_10023530 Ga0075362_100235304 411
142 3300006846 Ga0075430_100039096 Ga0075430_1000390964 411
143 3300025921 Ga0207652_10051751 Ga0207652_100517512 411
144 3300026121 Ga0207683_10083228 Ga0207683_100832283 411
145 3300035725 Ga0373947_0111746 Ga0373947_0111746_415_1689 411
146 3300036401 Ga0373937_0065504 Ga0373937_0065504_723_1970 411
147 3300039437 Ga0436365_0929432 Ga0436365_0929432_124_1398 411
148 3300046460 Ga0495638_0002563 Ga0495638_0002563_4268_5527 411
149 3300046660 Ga0495625_0000420 Ga0495625_0000420_31266_32525 411
150 3300050489 nmdc:mga03683_34878_c1 nmdc:mga03683_34878_c1_743_1999 411
151 3300002987 JGI25159J45721_1000092 JGI25159J45721_100009213 413
152 3300002987 JGI25159J45721_1000403 JGI25159J45721_10004039 413
153 3300003354 JGI25160J50197_1000134 JGI25160J50197_100013415 413
154 3300003374 JGI25161J50226_1000116 JGI25161J50226_100011629 413
155 3300003771 Ga0055526_1002223 Ga0055526_10022235 413
156 3300003775 Ga0055524_1001125 Ga0055524_10011255 413
157 3300003775 Ga0055524_1003343 Ga0055524_10033436 413
158 3300005262 Ga0065165_1000196 Ga0065165_100019649 413
159 3300005985 Ga0081539_10049131 Ga0081539_100491311 413
160 3300013249 Ga0171463_1014 Ga0171463_101444 413
161 3300015690 Ga0183363_1028 Ga0183363_102831 413
162 3300025284 Ga0209130_1000198 Ga0209130_100019844 413
163 3300025292 Ga0209676_1003330 Ga0209676_10033308 413
164 3300025294 Ga0209025_1000339 Ga0209025_100033947 413
165 3300025295 Ga0209564_1000353 Ga0209564_100035329 413
166 3300025298 Ga0209050_1004839 Ga0209050_10048398 413
167 3300025299 Ga0209256_1000368 Ga0209256_100036858 413
168 3300025299 Ga0209256_1000456 Ga0209256_100045646 413
169 3300025299 Ga0209256_1000884 Ga0209256_100088416 413
170 3300025302 Ga0207426_1000048 Ga0207426_1000048335 413
171 3300025304 Ga0209257_1002967 Ga0209257_100296712 413
172 3300041405 Ga0439438_033564 Ga0439438_033564_50_1306 413
173 3300047443 Ga0495687_032684 Ga0495687_032684_54_1307 413
174 3300048928 Ga0496125_0162554 Ga0496125_0162554_69_1340 413
175 3300053125 Ga0500618_000146 Ga0500618_000146_34297_35589 413
176 3300053161 Ga0500634_0002843 Ga0500634_0002843_5002_6294 413
177 iso_pu_bacteria 2643221607 2644048399 413
178 iso_pu_bacteria 2643221636 2644201760 413
179 iso_pu_bacteria 2643221686 2644481201 413

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00590

TP_methylase

Tetrapyrrole (Corrin/Porphyrin) Methylases

10

197

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3njr-assembly1.cif.gz_A crystal structure of c-terminal domain of precorrin-6y c5,15-methyltransferase from rhodobacter capsulatus 0.9526 227 412
3njr-assembly1.cif.gz_A crystal structure of c-terminal domain of precorrin-6y c5,15-methyltransferase from rhodobacter capsulatus 0.9476 227 412
3hm2-assembly2.cif.gz_H crystal structure of putative precorrin-6y c5,15-methyltransferase targeted domain from corynebacterium diphtheriae 0.9335 242 413
3hm2-assembly1.cif.gz_D crystal structure of putative precorrin-6y c5,15-methyltransferase targeted domain from corynebacterium diphtheriae 0.9298 242 413
3hm2-assembly2.cif.gz_H crystal structure of putative precorrin-6y c5,15-methyltransferase targeted domain from corynebacterium diphtheriae 0.9282 242 413
ID Description Score Start End Superfamily
af_P9WGA9_216_390_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9806 238 413 3.40.50.150
af_P9WGA9_216_390_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9696 238 413 3.40.50.150
3njrB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9499 227 409 3.40.50.150
af_P9WGA9_1_101_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.9323 16 116 3.40.1010.10
3njrB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.93 227 409 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A0F5LEH7-F1-model_v4 Precorrin-6Y C5,15-methyltransferase (Decarboxylating) (Precorrin-6Y methyltransferase) 0.9947 14 413 GO:0008276
GO:0009236
GO:0032259
AF-A0A0F5LEH7-F1-model_v4 Precorrin-6Y C5,15-methyltransferase (Decarboxylating) (Precorrin-6Y methyltransferase) 0.9898 14 413 GO:0008276
GO:0009236
GO:0032259
AF-A0A2R7KID8-F1-model_v4 deleted 0.9896 228 381
AF-A0A3S1Q8E7-F1-model_v4 Precorrin-6Y C5,15-methyltransferase (Decarboxylating) subunit CbiT 0.9875 156 321 GO:0008276
GO:0009236
GO:0032259
AF-A0A6V6ZYN5-F1-model_v4 deleted 0.9847 43 412

Feature Viewer

pLDDT pTM Quality
92.61 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map