F274203

General Info

Members Datasets Scaffolds Average Seq Length
179 115 358 119

Family's Representative Sequence

Representative Sequence 3300041443|Ga0451789_0543987|Ga0451789_0543987_73_432
Length 111
Sequence MEKVNVAQKLSTFNDYFNPRVAGELNGQQVKLVKFQGEFVWHFYVVKGSFDMHLRDKIITINEGEFLIVPKKIEHKPVAINEVEIMLFEPAATLNTGNVENELTRKELNKI

Samples

Sample ID Description Type Environment
1 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
84 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
85 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
86 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
87 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
88 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
92 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
93 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
94 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
97 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
98 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
99 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
100 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
101 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
102 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
103 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
104 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
105 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
106 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
107 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
108 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
109 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
110 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
111 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
112 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
113 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
114 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
115 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.23
Nodule 0
Rhizoplane 5.03
Rhizosphere 87.15
Stem 0
Stem Tuber 0
Unclassified 26.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451789_0543987 3300041443 Unclassified 505
2 CNXas_1000493 3300000545 Unclassified 2705
3 rootL2_10281201 3300003322 Bacteria 1329
4 Ga0065707_10154088 3300005295 Bacteria 1626
5 Ga0065707_10427463 3300005295 Bacteria 824
6 Ga0070690_100212585 3300005330 Bacteria 1351
7 Ga0070670_100121097 3300005331 Bacteria 2257
8 Ga0070670_101848764 3300005331 Bacteria 556
9 Ga0068869_100021617 3300005334 Bacteria 4428
10 Ga0070689_100495959 3300005340 Bacteria 1045
11 Ga0070687_100695615 3300005343 Bacteria 709
12 Ga0070669_100059839 3300005353 Unclassified 2797
13 Ga0070675_100676455 3300005354 Bacteria 939
14 Ga0070673_100523102 3300005364 Bacteria 1075
15 Ga0070667_100061527 3300005367 Bacteria 3179
16 Ga0070667_100708526 3300005367 Bacteria 932
17 Ga0070667_100750095 3300005367 Bacteria 905
18 Ga0070667_101200287 3300005367 Bacteria 710
19 Ga0070667_101422762 3300005367 Bacteria 650
20 Ga0070667_101455203 3300005367 Unclassified 643
21 Ga0070678_100768482 3300005456 Unclassified 873
22 Ga0068867_100183415 3300005459 Bacteria 1665
23 Ga0070698_100164979 3300005471 Bacteria 2158
24 Ga0068853_100001641 3300005539 Bacteria 16348
25 Ga0068853_100037857 3300005539 Bacteria 4107
26 Ga0068853_101197262 3300005539 Unclassified 733
27 Ga0068853_102340816 3300005539 Unclassified 517
28 Ga0070686_100342923 3300005544 Bacteria 1120
29 Ga0070686_100416455 3300005544 Unclassified 1025
30 Ga0070704_100169378 3300005549 Bacteria 1735
31 Ga0070664_100539145 3300005564 Bacteria 1078
32 Ga0068854_100708826 3300005578 Bacteria 869
33 Ga0070702_100184008 3300005615 Bacteria 1369
34 Ga0068859_100017443 3300005617 Bacteria 7216
35 Ga0068859_100305703 3300005617 Bacteria 1684
36 Ga0068864_100006857 3300005618 Bacteria 9332
37 Ga0068864_100164642 3300005618 Bacteria 2018
38 Ga0068866_10171114 3300005718 Bacteria 1275
39 Ga0068866_10750929 3300005718 Bacteria 674
40 Ga0068861_101287345 3300005719 Bacteria 710
41 Ga0068861_101626279 3300005719 Bacteria 637
42 Ga0068863_100019291 3300005841 Bacteria 6522
43 Ga0068863_100141197 3300005841 Bacteria 2302
44 Ga0068863_101957500 3300005841 Unclassified 596
45 Ga0068858_100235526 3300005842 Bacteria 1736
46 Ga0068858_101112526 3300005842 Bacteria 776
47 Ga0068860_100001796 3300005843 Bacteria 22849
48 Ga0068860_100154476 3300005843 Unclassified 2211
49 Ga0068862_100054800 3300005844 Bacteria 3414
50 Ga0068862_100150842 3300005844 Bacteria 2069
51 Ga0081455_11045990 3300005937 Bacteria 505
52 Ga0070715_10307060 3300006163 Bacteria 851
53 Ga0070715_10757739 3300006163 Unclassified 585
54 Ga0075366_10104144 3300006195 Bacteria 1705
55 Ga0075366_10126617 3300006195 Bacteria 1541
56 Ga0097621_100000407 3300006237 Bacteria 30013
57 Ga0097621_100058652 3300006237 Bacteria 3149
58 Ga0097621_101019704 3300006237 Bacteria 775
59 Ga0097621_101115681 3300006237 Unclassified 741
60 Ga0068871_100001038 3300006358 Bacteria 18605
61 Ga0068871_100013040 3300006358 Bacteria 6160
62 Ga0075428_101394151 3300006844 Unclassified 736
63 Ga0068865_100501157 3300006881 Bacteria 1012
64 Ga0097620_100017443 3300006931 Bacteria 7216
65 Ga0097620_100305730 3300006931 Bacteria 1684
66 Ga0105251_10256077 3300009011 Unclassified 789
67 Ga0105240_10002159 3300009093 Bacteria 32133
68 Ga0105240_10125253 3300009093 Unclassified 3089
69 Ga0111539_10014145 3300009094 Bacteria 9967
70 Ga0111539_11407556 3300009094 Bacteria 809
71 Ga0105247_10478565 3300009101 Bacteria 903
72 Ga0105241_10621895 3300009174 Bacteria 978
73 Ga0105248_13002514 3300009177 Bacteria 537
74 Ga0105237_10000171 3300009545 Bacteria 90778
75 Ga0105249_10001162 3300009553 Bacteria 23270
76 Ga0105249_11175492 3300009553 Bacteria 838
77 Ga0105249_11598950 3300009553 Bacteria 724
78 Ga0105249_11680046 3300009553 Bacteria 707
79 Ga0105249_12497237 3300009553 Bacteria 589
80 Ga0105239_10004967 3300010375 Bacteria 15708
81 Ga0105246_11192118 3300011119 Unclassified 700
82 Ga0157374_10861310 3300013296 Bacteria 923
83 Ga0157378_10010434 3300013297 Bacteria 8113
84 Ga0157378_10089555 3300013297 Unclassified 2795
85 Ga0163162_10000433 3300013306 Bacteria 38590
86 Ga0163162_10049866 3300013306 Unclassified 4197
87 Ga0163162_10090050 3300013306 Unclassified 3149
88 Ga0163162_11176214 3300013306 Bacteria 870
89 Ga0157375_10000118 3300013308 Bacteria 77255
90 Ga0157375_13621781 3300013308 Bacteria 514
91 Ga0163163_10000399 3300014325 Bacteria 41026
92 Ga0163163_11542128 3300014325 Unclassified 726
93 Ga0157380_10014273 3300014326 Bacteria 5811
94 Ga0157380_11327811 3300014326 Bacteria 767
95 Ga0157379_10631829 3300014968 Unclassified 1001
96 Ga0157379_11152766 3300014968 Bacteria 744
97 Ga0157379_11363443 3300014968 Unclassified 686
98 Ga0157376_10000813 3300014969 Bacteria 20454
99 Ga0157376_10741452 3300014969 Bacteria 991
100 Ga0163161_10001959 3300017792 Bacteria 14977
101 Ga0163161_10052073 3300017792 Bacteria 2967
102 Ga0163161_10979006 3300017792 Bacteria 721
103 Ga0207695_10007691 3300025913 Bacteria 13645
104 Ga0207671_10008202 3300025914 Bacteria 8900
105 Ga0207662_10665027 3300025918 Bacteria 728
106 Ga0207681_10179528 3300025923 Unclassified 1611
107 Ga0207650_10091316 3300025925 Bacteria 2327
108 Ga0207650_10505676 3300025925 Unclassified 1010
109 Ga0207650_11702863 3300025925 Bacteria 534
110 Ga0207659_10166141 3300025926 Bacteria 1737
111 Ga0207644_10052126 3300025931 Bacteria 2940
112 Ga0207670_10509035 3300025936 Bacteria 979
113 Ga0207704_10473043 3300025938 Bacteria 1004
114 Ga0207689_10362083 3300025942 Bacteria 1206
115 Ga0207667_10088149 3300025949 Bacteria 3210
116 Ga0207651_10926908 3300025960 Bacteria 776
117 Ga0207712_10002255 3300025961 Bacteria 12528
118 Ga0207712_10571364 3300025961 Bacteria 975
119 Ga0207712_10945489 3300025961 Bacteria 763
120 Ga0207668_11645560 3300025972 Unclassified 580
121 Ga0207658_10031324 3300025986 Unclassified 3775
122 Ga0207658_10862971 3300025986 Unclassified 823
123 Ga0207658_11345108 3300025986 Bacteria 653
124 Ga0207658_11790793 3300025986 Unclassified 560
125 Ga0207703_10022837 3300026035 Bacteria 4913
126 Ga0207703_10964920 3300026035 Bacteria 817
127 Ga0207639_10005565 3300026041 Bacteria 8519
128 Ga0207639_10282092 3300026041 Bacteria 1461
129 Ga0207639_11970625 3300026041 Unclassified 545
130 Ga0207641_10103021 3300026088 Bacteria 2517
131 Ga0207641_10253872 3300026088 Bacteria 1643
132 Ga0207641_11585736 3300026088 Unclassified 656
133 Ga0207648_10859225 3300026089 Bacteria 846
134 Ga0207676_10117170 3300026095 Bacteria 2240
135 Ga0207676_10132357 3300026095 Unclassified 2122
136 Ga0207676_10212215 3300026095 Bacteria 1718
137 Ga0207675_100123682 3300026118 Unclassified 2449
138 Ga0207675_101317373 3300026118 Bacteria 743
139 Ga0207675_102314838 3300026118 Unclassified 551
140 Ga0207683_10747411 3300026121 Unclassified 907
141 Ga0207698_10642452 3300026142 Unclassified 1050
142 Ga0268265_10141941 3300028380 Bacteria 2012
143 Ga0268264_10003099 3300028381 Bacteria 14392
144 Ga0268264_10113184 3300028381 Unclassified 2380
145 Ga0307517_10345215 3300028786 Unclassified 811
146 Ga0307515_10000001 3300028794 Bacteria 4259510
147 Ga0265327_10000099 3300031251 Bacteria 190474
148 Ga0307513_10178364 3300031456 Bacteria 1991
149 Ga0307509_10089534 3300031507 Bacteria 3156
150 Ga0307509_10860536 3300031507 Bacteria 571
151 Ga0316576_10451224 3300031727 Unclassified 950
152 Ga0307413_11299013 3300031824 Unclassified 636
153 Ga0307406_10352817 3300031901 Unclassified 1150
154 Ga0307414_10494407 3300032004 Unclassified 1081
155 Ga0373935_1415211 3300035692 Unclassified 520
156 Ga0316582_0488608 3300036647 Bacteria 849
157 Ga0316584_0761988 3300036712 Unclassified 660
158 Ga0373925_1490272 3300037068 Bacteria 554
159 Ga0439439_0252293 3300041406 Unclassified 523
160 Ga0451791_0136342 3300041451 Bacteria 531
161 Ga0451793_0202441 3300041452 Unclassified 520
162 Ga0451802_0261999 3300041460 Bacteria 1334
163 Ga0451837_0760997 3300041494 Bacteria 653
164 Ga0451847_0368557 3300041503 Bacteria 561
165 Ga0451843_1756169 3300041509 Unclassified 538
166 Ga0451853_4036889 3300041512 Bacteria 754
167 Ga0439460_0028265 3300042461 Bacteria 1581
168 Ga0453683_0162053 3300044673 Unclassified 1415
169 Ga0495672_0011556 3300047320 Bacteria 6224
170 Ga0495672_0090115 3300047320 Bacteria 1686
171 Ga0495686_0015526 3300047472 Bacteria 5194
172 Ga0496101_0415763 3300048904 Bacteria 1060
173 Ga0496104_0097902 3300048907 Bacteria 2808
174 Ga0496105_0580352 3300048908 Bacteria 872
175 Ga0496106_0316004 3300048909 Bacteria 1254
176 Ga0496114_0455848 3300048917 Bacteria 1132
177 nmdc:mga0k408_604214_c1 3300050493 Unclassified 647
178 nmdc:mga08y16_4372_c1 3300050511 Bacteria 14767
179 Ga0500611_000003 3300053727 Bacteria 333431
180 Ga0451789_0543987
181 CNXas_1000493
182 rootL2_10281201
183 Ga0065707_10154088
184 Ga0065707_10427463
185 Ga0070690_100212585
186 Ga0070670_100121097
187 Ga0070670_101848764
188 Ga0068869_100021617
189 Ga0070689_100495959
190 Ga0070687_100695615
191 Ga0070669_100059839
192 Ga0070675_100676455
193 Ga0070673_100523102
194 Ga0070667_100061527
195 Ga0070667_100708526
196 Ga0070667_100750095
197 Ga0070667_101200287
198 Ga0070667_101422762
199 Ga0070667_101455203
200 Ga0070678_100768482
201 Ga0068867_100183415
202 Ga0070698_100164979
203 Ga0068853_100001641
204 Ga0068853_100037857
205 Ga0068853_101197262
206 Ga0068853_102340816
207 Ga0070686_100342923
208 Ga0070686_100416455
209 Ga0070704_100169378
210 Ga0070664_100539145
211 Ga0068854_100708826
212 Ga0070702_100184008
213 Ga0068859_100017443
214 Ga0068859_100305703
215 Ga0068864_100006857
216 Ga0068864_100164642
217 Ga0068866_10171114
218 Ga0068866_10750929
219 Ga0068861_101287345
220 Ga0068861_101626279
221 Ga0068863_100019291
222 Ga0068863_100141197
223 Ga0068863_101957500
224 Ga0068858_100235526
225 Ga0068858_101112526
226 Ga0068860_100001796
227 Ga0068860_100154476
228 Ga0068862_100054800
229 Ga0068862_100150842
230 Ga0081455_11045990
231 Ga0070715_10307060
232 Ga0070715_10757739
233 Ga0075366_10104144
234 Ga0075366_10126617
235 Ga0097621_100000407
236 Ga0097621_100058652
237 Ga0097621_101019704
238 Ga0097621_101115681
239 Ga0068871_100001038
240 Ga0068871_100013040
241 Ga0075428_101394151
242 Ga0068865_100501157
243 Ga0097620_100017443
244 Ga0097620_100305730
245 Ga0105251_10256077
246 Ga0105240_10002159
247 Ga0105240_10125253
248 Ga0111539_10014145
249 Ga0111539_11407556
250 Ga0105247_10478565
251 Ga0105241_10621895
252 Ga0105248_13002514
253 Ga0105237_10000171
254 Ga0105249_10001162
255 Ga0105249_11175492
256 Ga0105249_11598950
257 Ga0105249_11680046
258 Ga0105249_12497237
259 Ga0105239_10004967
260 Ga0105246_11192118
261 Ga0157374_10861310
262 Ga0157378_10010434
263 Ga0157378_10089555
264 Ga0163162_10000433
265 Ga0163162_10049866
266 Ga0163162_10090050
267 Ga0163162_11176214
268 Ga0157375_10000118
269 Ga0157375_13621781
270 Ga0163163_10000399
271 Ga0163163_11542128
272 Ga0157380_10014273
273 Ga0157380_11327811
274 Ga0157379_10631829
275 Ga0157379_11152766
276 Ga0157379_11363443
277 Ga0157376_10000813
278 Ga0157376_10741452
279 Ga0163161_10001959
280 Ga0163161_10052073
281 Ga0163161_10979006
282 Ga0207695_10007691
283 Ga0207671_10008202
284 Ga0207662_10665027
285 Ga0207681_10179528
286 Ga0207650_10091316
287 Ga0207650_10505676
288 Ga0207650_11702863
289 Ga0207659_10166141
290 Ga0207644_10052126
291 Ga0207670_10509035
292 Ga0207704_10473043
293 Ga0207689_10362083
294 Ga0207667_10088149
295 Ga0207651_10926908
296 Ga0207712_10002255
297 Ga0207712_10571364
298 Ga0207712_10945489
299 Ga0207668_11645560
300 Ga0207658_10031324
301 Ga0207658_10862971
302 Ga0207658_11345108
303 Ga0207658_11790793
304 Ga0207703_10022837
305 Ga0207703_10964920
306 Ga0207639_10005565
307 Ga0207639_10282092
308 Ga0207639_11970625
309 Ga0207641_10103021
310 Ga0207641_10253872
311 Ga0207641_11585736
312 Ga0207648_10859225
313 Ga0207676_10117170
314 Ga0207676_10132357
315 Ga0207676_10212215
316 Ga0207675_100123682
317 Ga0207675_101317373
318 Ga0207675_102314838
319 Ga0207683_10747411
320 Ga0207698_10642452
321 Ga0268265_10141941
322 Ga0268264_10003099
323 Ga0268264_10113184
324 Ga0307517_10345215
325 Ga0307515_10000001
326 Ga0265327_10000099
327 Ga0307513_10178364
328 Ga0307509_10089534
329 Ga0307509_10860536
330 Ga0316576_10451224
331 Ga0307413_11299013
332 Ga0307406_10352817
333 Ga0307414_10494407
334 Ga0373935_1415211
335 Ga0316582_0488608
336 Ga0316584_0761988
337 Ga0373925_1490272
338 Ga0439439_0252293
339 Ga0451791_0136342
340 Ga0451793_0202441
341 Ga0451802_0261999
342 Ga0451837_0760997
343 Ga0451847_0368557
344 Ga0451843_1756169
345 Ga0451853_4036889
346 Ga0439460_0028265
347 Ga0453683_0162053
348 Ga0495672_0011556
349 Ga0495672_0090115
350 Ga0495686_0015526
351 Ga0496101_0415763
352 Ga0496104_0097902
353 Ga0496105_0580352
354 Ga0496106_0316004
355 Ga0496114_0455848
356 nmdc:mga0k408_604214_c1
357 nmdc:mga08y16_4372_c1
358 Ga0500611_000003

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d82-assembly1.cif.gz_E crystal structure of a cupin-2 domain containing protein (sfri_3543) from shewanella frigidimarina ncimb 400 at 2.05 a resolution 0.973 4 98
3dl3-assembly3.cif.gz_B crystal structure of the tellurite resistance protein tehb. northeast structural genomics consortium target vfr98 . 0.9288 39 96
3dl3-assembly4.cif.gz_I crystal structure of the tellurite resistance protein tehb. northeast structural genomics consortium target vfr98 . 0.9213 39 96
2i45-assembly4.cif.gz_H crystal structure of protein nmb1881 from neisseria meningitidis 0.917 2 99
2i45-assembly3.cif.gz_E crystal structure of protein nmb1881 from neisseria meningitidis 0.9163 2 99
ID Description Score Start End Superfamily
3d82C00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9554 1 98 2.60.120.10
3d82C00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9264 1 98 2.60.120.10
2i45I00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9072 3 97 2.60.120.10
3dl3I00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9036 39 96 2.60.120.10
af_Q95Q98_1_277_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.9029 30 96 2.60.120.650
ID Description Score Start End GO Terms
AF-A0A7W1FG58-F1-model_v4 Cupin domain-containing protein 0.9872 1 92
AF-A0A6B3GK81-F1-model_v4 Cupin domain-containing protein 0.9867 2 87
AF-A0A537BVB2-F1-model_v4 Cupin domain-containing protein 0.9828 5 93
AF-A0A5B8VGK6-F1-model_v4 Cupin domain-containing protein 0.9819 2 96
AF-A0A4Q3JHM8-F1-model_v4 deleted 0.9801 2 97

Map