F274096

General Info

Members Datasets Scaffolds Average Seq Length
179 136 177 131

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_101170748|Ga0307416_1011707482
Length 140
Sequence MYSVCVREHMMIAHSFTGEVFGPAQRLHGATYVIDVEFRRRELDANSIVVDIGRAGEALKSIVAQLNYRNLDDEPAFSGRNTTTEFLAKEIFDRLVARLRAGELGDAARDMDSLRVQLHESHVAWAAYEADVRTMLQARD

Samples

Sample ID Description Type Environment
1 2643221566 Microbacterium sp. Root166 Isolate Unclassified
2 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
68 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
69 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
70 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
71 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
72 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
73 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
74 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
75 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
76 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
77 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
78 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
79 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
83 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
84 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
87 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
88 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
89 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
90 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
91 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
92 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
93 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
94 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
99 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
100 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
101 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
102 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
103 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
106 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
109 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
110 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
111 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
112 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
113 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
114 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
115 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
116 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
117 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
118 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
119 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
120 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
121 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
122 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
123 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
127 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
128 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
132 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
133 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
134 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
135 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
136 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.77
Metatranscriptomes 1.12
Isolates 1.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.12
Nodule 0
Rhizoplane 13.41
Rhizosphere 79.89
Stem 0
Stem Tuber 0
Unclassified 5.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10029998 3300003203 Bacteria 2051
2 Ga0065704_10537180 3300005289 Bacteria 643
3 Ga0065715_10216389 3300005293 Bacteria 1291
4 Ga0065707_10082108 3300005295 Bacteria 21679
5 Ga0065707_10333458 3300005295 Bacteria 945
6 Ga0070690_100033766 3300005330 Bacteria 3204
7 Ga0070670_100960748 3300005331 Bacteria 776
8 Ga0070687_100013989 3300005343 Bacteria 3593
9 Ga0070668_101842931 3300005347 Bacteria 557
10 Ga0070673_100786408 3300005364 Bacteria 878
11 Ga0070667_100052323 3300005367 Bacteria 3446
12 Ga0070714_101006038 3300005435 Unclassified 811
13 Ga0070713_100039595 3300005436 Bacteria 3826
14 Ga0070706_100806065 3300005467 Bacteria 869
15 Ga0070684_101193699 3300005535 Bacteria 716
16 Ga0070665_101168041 3300005548 Bacteria 781
17 Ga0070665_101818811 3300005548 Bacteria 615
18 Ga0068856_101299585 3300005614 Bacteria 743
19 Ga0068859_100978547 3300005617 Bacteria 929
20 Ga0068859_101140922 3300005617 Bacteria 858
21 Ga0068859_101146951 3300005617 Bacteria 855
22 Ga0068866_10222440 3300005718 Bacteria 1140
23 Ga0068861_100086364 3300005719 Bacteria 2466
24 Ga0068858_100081255 3300005842 Bacteria 3013
25 Ga0068858_100091913 3300005842 Bacteria 2824
26 Ga0068860_100064268 3300005843 Bacteria 3486
27 Ga0068860_100086971 3300005843 Bacteria 2975
28 Ga0068860_101290337 3300005843 Bacteria 751
29 Ga0081539_10001518 3300005985 Bacteria 38975
30 Ga0081539_10250682 3300005985 Bacteria 787
31 Ga0070717_10175619 3300006028 Bacteria 1865
32 Ga0075363_100892297 3300006048 Bacteria 544
33 Ga0097621_100460331 3300006237 Bacteria 1147
34 Ga0097620_100978426 3300006931 Bacteria 929
35 Ga0097620_101141044 3300006931 Bacteria 858
36 Ga0097620_101146918 3300006931 Bacteria 855
37 Ga0105245_10785597 3300009098 Bacteria 989
38 Ga0105245_12414756 3300009098 Bacteria 579
39 Ga0105247_10277323 3300009101 Bacteria 1155
40 Ga0105243_10757548 3300009148 Bacteria 952
41 Ga0105242_12433161 3300009176 Bacteria 571
42 Ga0105248_10030492 3300009177 Bacteria 6022
43 Ga0157371_10512873 3300013102 Bacteria 886
44 Ga0157378_11940248 3300013297 Bacteria 638
45 Ga0157378_12529511 3300013297 Bacteria 565
46 Ga0163162_10698736 3300013306 Bacteria 1136
47 Ga0157372_11821588 3300013307 Bacteria 700
48 Ga0157375_11079569 3300013308 Bacteria 939
49 Ga0163163_10143320 3300014325 Bacteria 2432
50 Ga0163163_10910953 3300014325 Bacteria 943
51 Ga0163163_13317729 3300014325 Bacteria 502
52 Ga0157380_10000271 3300014326 Bacteria 31211
53 Ga0157380_10471646 3300014326 Bacteria 1211
54 Ga0157377_11116812 3300014745 Bacteria 605
55 Ga0157379_10008095 3300014968 Bacteria 9130
56 Ga0157379_11111332 3300014968 Bacteria 757
57 Ga0207692_10282099 3300025898 Bacteria 1005
58 Ga0207710_10015101 3300025900 Bacteria 3261
59 Ga0207684_11535056 3300025910 Bacteria 541
60 Ga0207657_10472117 3300025919 Bacteria 984
61 Ga0207700_10155764 3300025928 Bacteria 1893
62 Ga0207664_10004003 3300025929 Bacteria 9931
63 Ga0207664_10398454 3300025929 Bacteria 1224
64 Ga0207686_11592558 3300025934 Bacteria 539
65 Ga0207709_11640252 3300025935 Bacteria 534
66 Ga0207670_11209570 3300025936 Bacteria 640
67 Ga0207711_10027465 3300025941 Bacteria 4780
68 Ga0207679_10357499 3300025945 Bacteria 1275
69 Ga0207651_10178363 3300025960 Bacteria 1683
70 Ga0207712_10204577 3300025961 Bacteria 1568
71 Ga0207668_10352954 3300025972 Bacteria 1230
72 Ga0207658_10062155 3300025986 Bacteria 2794
73 Ga0207658_11839605 3300025986 Bacteria 552
74 Ga0207677_10076508 3300026023 Bacteria 2383
75 Ga0207703_10037342 3300026035 Bacteria 3869
76 Ga0207703_10976618 3300026035 Bacteria 812
77 Ga0207639_10903669 3300026041 Bacteria 825
78 Ga0207641_10055807 3300026088 Bacteria 3355
79 Ga0207648_10894960 3300026089 Bacteria 829
80 Ga0207676_10879110 3300026095 Bacteria 878
81 Ga0207675_100028980 3300026118 Bacteria 5158
82 Ga0207675_100733856 3300026118 Bacteria 998
83 Ga0268265_10549657 3300028380 Bacteria 1096
84 Ga0268265_11351502 3300028380 Bacteria 714
85 Ga0268264_10631048 3300028381 Bacteria 1059
86 Ga0268264_10747709 3300028381 Bacteria 974
87 Ga0265338_10078224 3300028800 Bacteria 2791
88 Ga0307512_10005729 3300030522 Bacteria 12823
89 Ga0265331_10114134 3300031250 Bacteria 1237
90 Ga0307509_10098868 3300031507 Bacteria 2961
91 Ga0316579_10113950 3300031691 Bacteria 1298
92 Ga0316576_10015354 3300031727 Bacteria 5138
93 Ga0316576_10052863 3300031727 Bacteria 2958
94 Ga0316578_10012267 3300031728 Bacteria 4515
95 Ga0316578_10444276 3300031728 Bacteria 766
96 Ga0307405_10025585 3300031731 Bacteria 3391
97 Ga0316577_10101058 3300031733 Bacteria 1616
98 Ga0307413_10626605 3300031824 Bacteria 884
99 Ga0307410_11323099 3300031852 Bacteria 631
100 Ga0307406_10859491 3300031901 Bacteria 770
101 Ga0307407_11561645 3300031903 Bacteria 523
102 Ga0307416_101170748 3300032002 Unclassified 874
103 Ga0307415_100217824 3300032126 Bacteria 1528
104 Ga0307415_102065251 3300032126 Bacteria 556
105 Ga0316585_10029654 3300032137 Bacteria 1714
106 Ga0316585_10058643 3300032137 Bacteria 1241
107 Ga0316580_10035245 3300032139 Bacteria 1548
108 Ga0316588_1083897 3300033528 Bacteria 790
109 Ga0316596_1083336 3300033541 Bacteria 860
110 Ga0373959_0016771 3300034820 Bacteria 1361
111 Ga0373928_0001724 3300035084 Bacteria 4246
112 Ga0373951_0000017 3300035091 Bacteria 65961
113 Ga0373942_0000818 3300035207 Bacteria 8582
114 Ga0316574_0016177 3300035398 Bacteria 4342
115 Ga0373931_0052381 3300035691 Bacteria 2175
116 Ga0373935_0040958 3300035692 Bacteria 2908
117 Ga0316582_0062534 3300036647 Bacteria 2390
118 Ga0316584_0011520 3300036712 Bacteria 6215
119 Ga0395900_0136115 3300037418 Bacteria 2517
120 Ga0395901_0015233 3300038443 Bacteria 7824
121 Ga0436365_0239098 3300039437 Bacteria 741
122 Ga0451791_0511330 3300041451 Bacteria 891
123 Ga0451837_1772367 3300041494 Bacteria 1090
124 Ga0451853_0252277 3300041512 Bacteria 4860
125 Ga0451853_0572128 3300041512 Bacteria 521
126 Ga0451853_3849857 3300041512 Bacteria 1308
127 Ga0439463_106160 3300042016 Bacteria 725
128 Ga0466972_0041264 3300044658 Bacteria 2247
129 Ga0466965_0132592 3300044683 Bacteria 1293
130 Ga0466965_0223453 3300044683 Bacteria 1004
131 Ga0466963_1105779 3300044694 Bacteria 557
132 Ga0466970_0376598 3300044765 Bacteria 808
133 Ga0466970_0879653 3300044765 Bacteria 526
134 Ga0451576_0002046 3300045051 Bacteria 31751
135 Ga0466967_0057353 3300045976 Bacteria 3438
136 Ga0466967_0279846 3300045976 Bacteria 1600
137 Ga0466967_0783176 3300045976 Bacteria 947
138 Ga0495638_0001812 3300046460 Bacteria 18567
139 Ga0495650_0247964 3300046471 Unclassified 606
140 Ga0495643_0003099 3300046522 Bacteria 12447
141 Ga0495598_0109812 3300046537 Bacteria 923
142 Ga0495621_0066222 3300046539 Unclassified 1321
143 Ga0495672_0439803 3300047320 Bacteria 590
144 Ga0496100_0043571 3300048903 Bacteria 2871
145 Ga0496101_0309174 3300048904 Bacteria 1239
146 Ga0496102_0959516 3300048905 Bacteria 776
147 Ga0496104_0034169 3300048907 Bacteria 4739
148 Ga0496104_0786606 3300048907 Bacteria 858
149 Ga0496105_0447132 3300048908 Bacteria 1021
150 Ga0496106_0165434 3300048909 Bacteria 1751
151 Ga0496107_0390223 3300048910 Bacteria 1035
152 Ga0496107_0704109 3300048910 Bacteria 743
153 Ga0496108_0714057 3300048911 Bacteria 869
154 Ga0496108_1062815 3300048911 Bacteria 689
155 Ga0496109_0057894 3300048912 Bacteria 3539
156 Ga0496109_0074076 3300048912 Bacteria 3130
157 Ga0496109_0523501 3300048912 Bacteria 1119
158 Ga0496110_1147564 3300048913 Bacteria 685
159 Ga0496112_0006016 3300048915 Bacteria 10590
160 Ga0496112_0023292 3300048915 Bacteria 5914
161 Ga0496113_0020491 3300048916 Bacteria 4649
162 Ga0496114_0065777 3300048917 Bacteria 3038
163 Ga0496114_0071889 3300048917 Bacteria 2908
164 Ga0496114_0147206 3300048917 Bacteria 2042
165 Ga0496114_0160272 3300048917 Bacteria 1956
166 Ga0496114_1627989 3300048917 Bacteria 534
167 Ga0496117_0445860 3300048920 Bacteria 641
168 Ga0496118_0024379 3300048921 Bacteria 5222
169 Ga0501034_0544086 3300049571 Bacteria 1071
170 Ga0501047_0416597 3300049581 Bacteria 1175
171 Ga0501069_0652968 3300049585 Bacteria 633
172 Ga0501071_0327550 3300049587 Bacteria 1164
173 Ga0501080_0691667 3300049742 Bacteria 900
174 nmdc:mga0n895_194902_c1 3300050512 Bacteria 2057
175 nmdc:mga0rr50_1385827_c1 3300050513 Bacteria 595
176 nmdc:mga0rr50_91839_c1 3300050513 Bacteria 2366
177 Ga0500568_0103279 3300053139 Bacteria 1068

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014325 Ga0163163_13317729 Ga0163163_133177291 114
2 3300048917 Ga0496114_1627989 Ga0496114_1627989_167_514 115
3 3300005347 Ga0070668_101842931 Ga0070668_1018429312 118
4 3300026118 Ga0207675_100733856 Ga0207675_1007338562 118
5 3300025935 Ga0207709_11640252 Ga0207709_116402521 121
6 3300005330 Ga0070690_100033766 Ga0070690_1000337664 122
7 3300005343 Ga0070687_100013989 Ga0070687_1000139891 122
8 3300013102 Ga0157371_10512873 Ga0157371_105128732 122
9 3300034820 Ga0373959_0016771 Ga0373959_0016771_19_390 122
10 3300035084 Ga0373928_0001724 Ga0373928_0001724_1174_1545 122
11 3300035207 Ga0373942_0000818 Ga0373942_0000818_8189_8560 122
12 3300035691 Ga0373931_0052381 Ga0373931_0052381_23_394 122
13 3300041512 Ga0451853_0572128 Ga0451853_0572128_131_499 122
14 3300045051 Ga0451576_0002046 Ga0451576_0002046_19205_19576 122
15 3300046522 Ga0495643_0003099 Ga0495643_0003099_11041_11409 122
16 3300046539 Ga0495621_0066222 Ga0495621_0066222_10_387 122
17 3300048909 Ga0496106_0165434 Ga0496106_0165434_1148_1519 122
18 3300048910 Ga0496107_0704109 Ga0496107_0704109_51_422 122
19 3300050512 nmdc:mga0n895_194902_c1 nmdc:mga0n895_194902_c1_1331_1702 122
20 3300050513 nmdc:mga0rr50_91839_c1 nmdc:mga0rr50_91839_c1_1813_2184 122
21 3300044694 Ga0466963_1105779 Ga0466963_1105779_108_479 123
22 3300044765 Ga0466970_0376598 Ga0466970_0376598_22_393 123
23 3300047320 Ga0495672_0439803 Ga0495672_0439803_35_415 123
24 3300049571 Ga0501034_0544086 Ga0501034_0544086_128_508 123
25 3300049581 Ga0501047_0416597 Ga0501047_0416597_555_935 123
26 3300048907 Ga0496104_0034169 Ga0496104_0034169_3538_3915 125
27 3300048912 Ga0496109_0074076 Ga0496109_0074076_1659_2036 125
28 3300048915 Ga0496112_0023292 Ga0496112_0023292_64_441 125
29 3300048905 Ga0496102_0959516 Ga0496102_0959516_352_732 126
30 3300005367 Ga0070667_100052323 Ga0070667_1000523232 127
31 3300005617 Ga0068859_101140922 Ga0068859_1011409222 127
32 3300005842 Ga0068858_100081255 Ga0068858_1000812553 127
33 3300005843 Ga0068860_100064268 Ga0068860_1000642684 127
34 3300006931 Ga0097620_101141044 Ga0097620_1011410442 127
35 3300013297 Ga0157378_11940248 Ga0157378_119402481 127
36 3300013306 Ga0163162_10698736 Ga0163162_106987362 127
37 3300025972 Ga0207668_10352954 Ga0207668_103529542 127
38 3300025986 Ga0207658_10062155 Ga0207658_100621552 127
39 3300026035 Ga0207703_10037342 Ga0207703_100373423 127
40 3300026088 Ga0207641_10055807 Ga0207641_100558074 127
41 3300026095 Ga0207676_10879110 Ga0207676_108791101 127
42 3300028381 Ga0268264_10631048 Ga0268264_106310482 127
43 3300045976 Ga0466967_0057353 Ga0466967_0057353_657_1055 127
44 iso_pu_bacteria 2643221566 2643847165 127
45 3300009098 Ga0105245_10785597 Ga0105245_107855972 128
46 3300009101 Ga0105247_10277323 Ga0105247_102773232 128
47 3300009176 Ga0105242_12433161 Ga0105242_124331611 128
48 3300025934 Ga0207686_11592558 Ga0207686_115925581 128
49 3300048903 Ga0496100_0043571 Ga0496100_0043571_122_508 128
50 3300048904 Ga0496101_0309174 Ga0496101_0309174_330_716 128
51 3300048908 Ga0496105_0447132 Ga0496105_0447132_416_802 128
52 3300048910 Ga0496107_0390223 Ga0496107_0390223_418_804 128
53 3300048911 Ga0496108_1062815 Ga0496108_1062815_94_480 128
54 3300048912 Ga0496109_0057894 Ga0496109_0057894_28_414 128
55 3300048913 Ga0496110_1147564 Ga0496110_1147564_27_413 128
56 3300048915 Ga0496112_0006016 Ga0496112_0006016_877_1263 128
57 3300048916 Ga0496113_0020491 Ga0496113_0020491_3170_3556 128
58 3300048917 Ga0496114_0160272 Ga0496114_0160272_129_515 128
59 3300050513 nmdc:mga0rr50_1385827_c1 nmdc:mga0rr50_1385827_c1_34_420 128
60 iso_pu_bacteria 2751185782 2753271339 128
61 3300006048 Ga0075363_100892297 Ga0075363_1008922972 129
62 3300044683 Ga0466965_0132592 Ga0466965_0132592_877_1269 130
63 3300014968 Ga0157379_11111332 Ga0157379_111113322 131
64 3300003203 JGI25406J46586_10029998 JGI25406J46586_100299983 132
65 3300005289 Ga0065704_10537180 Ga0065704_105371801 132
66 3300005293 Ga0065715_10216389 Ga0065715_102163892 132
67 3300005295 Ga0065707_10082108 Ga0065707_100821084 132
68 3300005295 Ga0065707_10333458 Ga0065707_103334582 132
69 3300005331 Ga0070670_100960748 Ga0070670_1009607482 132
70 3300005364 Ga0070673_100786408 Ga0070673_1007864082 132
71 3300005435 Ga0070714_101006038 Ga0070714_1010060382 132
72 3300005436 Ga0070713_100039595 Ga0070713_1000395953 132
73 3300005467 Ga0070706_100806065 Ga0070706_1008060651 132
74 3300005535 Ga0070684_101193699 Ga0070684_1011936991 132
75 3300005548 Ga0070665_101168041 Ga0070665_1011680412 132
76 3300005548 Ga0070665_101818811 Ga0070665_1018188112 132
77 3300005614 Ga0068856_101299585 Ga0068856_1012995852 132
78 3300005617 Ga0068859_100978547 Ga0068859_1009785472 132
79 3300005617 Ga0068859_101146951 Ga0068859_1011469512 132
80 3300005718 Ga0068866_10222440 Ga0068866_102224401 132
81 3300005719 Ga0068861_100086364 Ga0068861_1000863642 132
82 3300005842 Ga0068858_100091913 Ga0068858_1000919131 132
83 3300005843 Ga0068860_100086971 Ga0068860_1000869712 132
84 3300005843 Ga0068860_101290337 Ga0068860_1012903371 132
85 3300005985 Ga0081539_10001518 Ga0081539_1000151829 132
86 3300005985 Ga0081539_10250682 Ga0081539_102506822 132
87 3300006028 Ga0070717_10175619 Ga0070717_101756192 132
88 3300006237 Ga0097621_100460331 Ga0097621_1004603312 132
89 3300006931 Ga0097620_100978426 Ga0097620_1009784262 132
90 3300006931 Ga0097620_101146918 Ga0097620_1011469182 132
91 3300009098 Ga0105245_12414756 Ga0105245_124147561 132
92 3300009148 Ga0105243_10757548 Ga0105243_107575482 132
93 3300009177 Ga0105248_10030492 Ga0105248_100304922 132
94 3300013297 Ga0157378_12529511 Ga0157378_125295112 132
95 3300013307 Ga0157372_11821588 Ga0157372_118215882 132
96 3300013308 Ga0157375_11079569 Ga0157375_110795692 132
97 3300014325 Ga0163163_10143320 Ga0163163_101433202 132
98 3300014325 Ga0163163_10910953 Ga0163163_109109532 132
99 3300014326 Ga0157380_10000271 Ga0157380_100002719 132
100 3300014326 Ga0157380_10471646 Ga0157380_104716462 132
101 3300014745 Ga0157377_11116812 Ga0157377_111168122 132
102 3300014968 Ga0157379_10008095 Ga0157379_100080957 132
103 3300025898 Ga0207692_10282099 Ga0207692_102820991 132
104 3300025900 Ga0207710_10015101 Ga0207710_100151013 132
105 3300025910 Ga0207684_11535056 Ga0207684_115350561 132
106 3300025919 Ga0207657_10472117 Ga0207657_104721172 132
107 3300025928 Ga0207700_10155764 Ga0207700_101557643 132
108 3300025929 Ga0207664_10004003 Ga0207664_100040033 132
109 3300025929 Ga0207664_10398454 Ga0207664_103984542 132
110 3300025936 Ga0207670_11209570 Ga0207670_112095702 132
111 3300025941 Ga0207711_10027465 Ga0207711_100274653 132
112 3300025945 Ga0207679_10357499 Ga0207679_103574992 132
113 3300025960 Ga0207651_10178363 Ga0207651_101783633 132
114 3300025961 Ga0207712_10204577 Ga0207712_102045772 132
115 3300025986 Ga0207658_11839605 Ga0207658_118396052 132
116 3300026023 Ga0207677_10076508 Ga0207677_100765083 132
117 3300026035 Ga0207703_10976618 Ga0207703_109766182 132
118 3300026041 Ga0207639_10903669 Ga0207639_109036692 132
119 3300026089 Ga0207648_10894960 Ga0207648_108949602 132
120 3300026118 Ga0207675_100028980 Ga0207675_1000289802 132
121 3300028380 Ga0268265_10549657 Ga0268265_105496572 132
122 3300028380 Ga0268265_11351502 Ga0268265_113515021 132
123 3300028381 Ga0268264_10747709 Ga0268264_107477092 132
124 3300028800 Ga0265338_10078224 Ga0265338_100782242 132
125 3300030522 Ga0307512_10005729 Ga0307512_1000572911 132
126 3300031250 Ga0265331_10114134 Ga0265331_101141342 132
127 3300031507 Ga0307509_10098868 Ga0307509_100988681 132
128 3300031691 Ga0316579_10113950 Ga0316579_101139502 132
129 3300031727 Ga0316576_10015354 Ga0316576_100153547 132
130 3300031727 Ga0316576_10052863 Ga0316576_100528633 132
131 3300031728 Ga0316578_10012267 Ga0316578_100122674 132
132 3300031728 Ga0316578_10444276 Ga0316578_104442761 132
133 3300031731 Ga0307405_10025585 Ga0307405_100255852 132
134 3300031733 Ga0316577_10101058 Ga0316577_101010582 132
135 3300031824 Ga0307413_10626605 Ga0307413_106266052 132
136 3300031852 Ga0307410_11323099 Ga0307410_113230992 132
137 3300031901 Ga0307406_10859491 Ga0307406_108594912 132
138 3300031903 Ga0307407_11561645 Ga0307407_115616451 132
139 3300032002 Ga0307416_101170748 Ga0307416_1011707482 132
140 3300032126 Ga0307415_100217824 Ga0307415_1002178242 132
141 3300032126 Ga0307415_102065251 Ga0307415_1020652511 132
142 3300032137 Ga0316585_10029654 Ga0316585_100296542 132
143 3300032137 Ga0316585_10058643 Ga0316585_100586432 132
144 3300032139 Ga0316580_10035245 Ga0316580_100352452 132
145 3300033528 Ga0316588_1083897 Ga0316588_10838971 132
146 3300033541 Ga0316596_1083336 Ga0316596_10833361 132
147 3300035091 Ga0373951_0000017 Ga0373951_0000017_50328_50726 132
148 3300035398 Ga0316574_0016177 Ga0316574_0016177_3126_3530 132
149 3300035692 Ga0373935_0040958 Ga0373935_0040958_84_482 132
150 3300036647 Ga0316582_0062534 Ga0316582_0062534_1001_1405 132
151 3300036712 Ga0316584_0011520 Ga0316584_0011520_2797_3213 132
152 3300037418 Ga0395900_0136115 Ga0395900_0136115_1515_1913 132
153 3300038443 Ga0395901_0015233 Ga0395901_0015233_790_1188 132
154 3300039437 Ga0436365_0239098 Ga0436365_0239098_306_704 132
155 3300041451 Ga0451791_0511330 Ga0451791_0511330_319_717 132
156 3300041494 Ga0451837_1772367 Ga0451837_1772367_344_742 132
157 3300041512 Ga0451853_0252277 Ga0451853_0252277_2165_2566 132
158 3300041512 Ga0451853_3849857 Ga0451853_3849857_613_1020 132
159 3300042016 Ga0439463_106160 Ga0439463_106160_104_502 132
160 3300044658 Ga0466972_0041264 Ga0466972_0041264_258_656 132
161 3300044683 Ga0466965_0223453 Ga0466965_0223453_145_543 132
162 3300044765 Ga0466970_0879653 Ga0466970_0879653_100_501 132
163 3300045976 Ga0466967_0279846 Ga0466967_0279846_474_878 132
164 3300045976 Ga0466967_0783176 Ga0466967_0783176_145_543 132
165 3300046460 Ga0495638_0001812 Ga0495638_0001812_11192_11590 132
166 3300046471 Ga0495650_0247964 Ga0495650_0247964_177_578 132
167 3300046537 Ga0495598_0109812 Ga0495598_0109812_500_907 132
168 3300048907 Ga0496104_0786606 Ga0496104_0786606_224_628 132
169 3300048911 Ga0496108_0714057 Ga0496108_0714057_295_699 132
170 3300048912 Ga0496109_0523501 Ga0496109_0523501_429_827 132
171 3300048917 Ga0496114_0065777 Ga0496114_0065777_843_1247 132
172 3300048917 Ga0496114_0071889 Ga0496114_0071889_1725_2129 132
173 3300048917 Ga0496114_0147206 Ga0496114_0147206_1048_1446 132
174 3300048920 Ga0496117_0445860 Ga0496117_0445860_63_461 132
175 3300048921 Ga0496118_0024379 Ga0496118_0024379_4068_4466 132
176 3300049585 Ga0501069_0652968 Ga0501069_0652968_141_539 132
177 3300049587 Ga0501071_0327550 Ga0501071_0327550_546_944 132
178 3300049742 Ga0501080_0691667 Ga0501080_0691667_160_558 132
179 3300053139 Ga0500568_0103279 Ga0500568_0103279_571_969 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01242

PTPS

6-pyruvoyl tetrahydropterin synthase

3

131

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d7j-assembly1.cif.gz_D sco6650, a 6-pyruvoyltetrahydropterin synthase homolog from streptomyces coelicolor 0.9879 2 132
3d7j-assembly1.cif.gz_D sco6650, a 6-pyruvoyltetrahydropterin synthase homolog from streptomyces coelicolor 0.9732 2 132
4ntk-assembly1.cif.gz_D qued from e. coli 0.8517 1 128
4ntm-assembly1.cif.gz_C qued soaked with sepiapterin (selenomethionine substituted protein) 0.8473 1 128
4ntm-assembly1.cif.gz_C qued soaked with sepiapterin (selenomethionine substituted protein) 0.8341 1 128
ID Description Score Start End Superfamily
3d7jC00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9874 2 132 3.30.479.10
3d7jC00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9653 2 132 3.30.479.10
4ntmA00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.816 1 130 3.30.479.10
4ntmA00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8094 1 130 3.30.479.10
2g64A00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8011 2 130 3.30.479.10
ID Description Score Start End GO Terms
AF-A0A2N2S8J1-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9934 1 119 GO:0046872
GO:0070497
AF-A0A7K2MGU2-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9934 1 89 GO:0046872
GO:0070497
AF-C9ZBP0-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9909 2 132 GO:0046872
GO:0070497
AF-A0A136PI54-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9902 1 105 GO:0046872
GO:0070497
AF-A0A1V2QES6-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9901 1 131 GO:0046872
GO:0070497

Feature Viewer

pLDDT pTM Quality
93.02 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map