F274080

General Info

Members Datasets Scaffolds Average Seq Length
179 119 358 75

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_11322056|Ga0307410_113220562
Length 84
Sequence MPNVKHCITMIKTITKIGNSHGIIFDSTLLQLSHLKPGDEVNVEVHPGGTITITPMNPQPTPAEFSAKIEDVMQRYARTMKRLA

Samples

Sample ID Description Type Environment
1 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
56 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
72 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
73 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
74 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
75 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
76 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
79 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
80 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
81 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
82 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
83 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
84 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
89 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
90 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
94 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
95 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
96 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
97 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
98 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
99 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
100 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
101 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
102 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
103 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
104 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
105 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
106 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
107 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
108 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
109 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
114 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
115 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
117 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
118 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
119 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 0
Rhizosphere 97.21
Stem 0
Stem Tuber 0
Unclassified 32.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307410_11322056 3300031852 Unclassified 631
2 rootH2_10015336 3300003320 Bacteria 12431
3 rootH2_10209438 3300003320 Bacteria 3245
4 rootH1_10267389 3300003323 Bacteria 1903
5 Ga0065704_10617981 3300005289 Bacteria 598
6 Ga0070676_10653688 3300005328 Bacteria 763
7 Ga0070690_100360733 3300005330 Unclassified 1057
8 Ga0070690_100569238 3300005330 Unclassified 856
9 Ga0070690_101225628 3300005330 Unclassified 599
10 Ga0070677_10338278 3300005333 Bacteria 776
11 Ga0070689_100046855 3300005340 Bacteria 3332
12 Ga0070668_100165668 3300005347 Bacteria 1796
13 Ga0070668_100293264 3300005347 Bacteria 1362
14 Ga0070668_101041030 3300005347 Bacteria 737
15 Ga0070675_100502522 3300005354 Bacteria 1092
16 Ga0070671_100435864 3300005355 Unclassified 1123
17 Ga0070674_101028917 3300005356 Bacteria 724
18 Ga0070673_102260188 3300005364 Unclassified 517
19 Ga0070688_100353467 3300005365 Bacteria 1076
20 Ga0070688_101590223 3300005365 Unclassified 533
21 Ga0070714_100533981 3300005435 Bacteria 1121
22 Ga0070714_101211495 3300005435 Unclassified 736
23 Ga0070713_100072174 3300005436 Bacteria 2919
24 Ga0070710_10126282 3300005437 Unclassified 1554
25 Ga0070701_10151953 3300005438 Bacteria 1334
26 Ga0070711_100252337 3300005439 Unclassified 1384
27 Ga0070711_101381059 3300005439 Bacteria 612
28 Ga0070705_100273522 3300005440 Bacteria 1197
29 Ga0070708_100127191 3300005445 Bacteria 2356
30 Ga0070708_100266700 3300005445 Bacteria 1610
31 Ga0070708_100488901 3300005445 Unclassified 1161
32 Ga0070708_100507175 3300005445 Bacteria 1138
33 Ga0070708_101438611 3300005445 Unclassified 643
34 Ga0070706_100206283 3300005467 Bacteria 1835
35 Ga0070706_101114198 3300005467 Unclassified 726
36 Ga0070706_101974542 3300005467 Unclassified 529
37 Ga0070707_100277964 3300005468 Bacteria 1627
38 Ga0070707_100592734 3300005468 Bacteria 1071
39 Ga0070698_100040336 3300005471 Bacteria 4798
40 Ga0070698_100831080 3300005471 Bacteria 868
41 Ga0070699_100503276 3300005518 Unclassified 1101
42 Ga0070679_101150356 3300005530 Bacteria 721
43 Ga0070697_100016626 3300005536 Bacteria 5787
44 Ga0070697_100025602 3300005536 Bacteria 4706
45 Ga0070697_100115362 3300005536 Unclassified 2242
46 Ga0070697_100204642 3300005536 Bacteria 1678
47 Ga0070686_100177946 3300005544 Bacteria 1509
48 Ga0070686_101337561 3300005544 Unclassified 599
49 Ga0070695_100400124 3300005545 Unclassified 1041
50 Ga0070704_100567105 3300005549 Bacteria 994
51 Ga0070704_100836562 3300005549 Unclassified 824
52 Ga0068855_100364695 3300005563 Bacteria 1589
53 Ga0068859_100902284 3300005617 Bacteria 968
54 Ga0068859_101662458 3300005617 Bacteria 705
55 Ga0068866_10334540 3300005718 Bacteria 957
56 Ga0068863_101516912 3300005841 Bacteria 679
57 Ga0068862_100502874 3300005844 Bacteria 1151
58 Ga0081455_10091453 3300005937 Bacteria 2464
59 Ga0081538_10036677 3300005981 Bacteria 3195
60 Ga0070717_10113794 3300006028 Unclassified 2310
61 Ga0070717_10603872 3300006028 Bacteria 995
62 Ga0070716_100095180 3300006173 Bacteria 1812
63 Ga0070716_100316446 3300006173 Bacteria 1092
64 Ga0070712_100091306 3300006175 Bacteria 2231
65 Ga0070712_100150690 3300006175 Bacteria 1785
66 Ga0097620_100902224 3300006931 Bacteria 968
67 Ga0097620_101663126 3300006931 Bacteria 705
68 Ga0075435_100480335 3300007076 Bacteria 1073
69 Ga0099794_10224683 3300007265 Bacteria 965
70 Ga0114129_12945291 3300009147 Unclassified 561
71 Ga0105243_10386264 3300009148 Bacteria 1296
72 Ga0105242_12812271 3300009176 Unclassified 537
73 Ga0105249_10181241 3300009553 Bacteria 2049
74 Ga0105249_12304736 3300009553 Unclassified 611
75 Ga0105249_13428091 3300009553 Bacteria 510
76 Ga0157371_10089098 3300013102 Bacteria 2185
77 Ga0157370_10554821 3300013104 Bacteria 1053
78 Ga0157374_10160525 3300013296 Bacteria 2189
79 Ga0157374_10800141 3300013296 Unclassified 958
80 Ga0157378_12052291 3300013297 Unclassified 622
81 Ga0157375_12165310 3300013308 Unclassified 662
82 Ga0157375_13056264 3300013308 Unclassified 558
83 Ga0157375_13480569 3300013308 Unclassified 524
84 Ga0163163_11442670 3300014325 Unclassified 750
85 Ga0157380_10074861 3300014326 Bacteria 2750
86 Ga0224572_1073355 3300024225 Unclassified 632
87 Ga0207692_10675675 3300025898 Bacteria 669
88 Ga0207692_10705024 3300025898 Unclassified 655
89 Ga0207642_10077098 3300025899 Bacteria 1607
90 Ga0207699_10485825 3300025906 Unclassified 890
91 Ga0207684_10058343 3300025910 Bacteria 3275
92 Ga0207684_10275736 3300025910 Bacteria 1451
93 Ga0207684_11349540 3300025910 Bacteria 585
94 Ga0207693_10277989 3300025915 Bacteria 1312
95 Ga0207693_10546400 3300025915 Unclassified 903
96 Ga0207663_10337567 3300025916 Unclassified 1137
97 Ga0207646_10016824 3300025922 Bacteria 6858
98 Ga0207646_10507390 3300025922 Bacteria 1086
99 Ga0207646_10939248 3300025922 Unclassified 766
100 Ga0207659_11304274 3300025926 Unclassified 623
101 Ga0207664_10039030 3300025929 Unclassified 3684
102 Ga0207670_10032981 3300025936 Bacteria 3334
103 Ga0207665_10057538 3300025939 Bacteria 2626
104 Ga0207712_10628140 3300025961 Bacteria 932
105 Ga0207668_10127087 3300025972 Bacteria 1941
106 Ga0207648_10400669 3300026089 Bacteria 1243
107 Ga0268265_10468908 3300028380 Bacteria 1180
108 Ga0265337_1009646 3300028556 Unclassified 3433
109 Ga0265337_1049921 3300028556 Bacteria 1180
110 Ga0265326_10091771 3300028558 Bacteria 860
111 Ga0265319_1025953 3300028563 Bacteria 2092
112 Ga0265318_10034594 3300028577 Bacteria 1947
113 Ga0265322_10080574 3300028654 Bacteria 924
114 Ga0265322_10121940 3300028654 Bacteria 742
115 Ga0265336_10018162 3300028666 Bacteria 2282
116 Ga0265336_10173162 3300028666 Unclassified 642
117 Ga0265338_10055497 3300028800 Bacteria 3523
118 Ga0265338_10061795 3300028800 Bacteria 3280
119 Ga0265338_10068196 3300028800 Unclassified 3066
120 Ga0265338_10083820 3300028800 Bacteria 2664
121 Ga0265338_10205292 3300028800 Unclassified 1483
122 Ga0265338_10217398 3300028800 Bacteria 1430
123 Ga0265324_10002554 3300029957 Bacteria 9202
124 Ga0265324_10002694 3300029957 Bacteria 8860
125 Ga0265328_10103008 3300031239 Bacteria 1058
126 Ga0265320_10057618 3300031240 Bacteria 1863
127 Ga0265320_10374080 3300031240 Bacteria 629
128 Ga0265339_10142769 3300031249 Bacteria 1217
129 Ga0265327_10045778 3300031251 Bacteria 2322
130 Ga0265316_10070125 3300031344 Bacteria 2704
131 Ga0265314_10000806 3300031711 Bacteria 37286
132 Ga0307406_10935272 3300031901 Unclassified 740
133 Ga0307412_10000040 3300031911 Bacteria 182923
134 Ga0307412_10092551 3300031911 Bacteria 2119
135 Ga0307412_11920229 3300031911 Unclassified 547
136 Ga0307416_100316366 3300032002 Bacteria 1560
137 Ga0307414_10866376 3300032004 Unclassified 827
138 Ga0307414_12121422 3300032004 Unclassified 525
139 Ga0307411_10601878 3300032005 Unclassified 945
140 Ga0307411_11195199 3300032005 Bacteria 689
141 Ga0373943_0737445 3300035170 Unclassified 585
142 Ga0373937_0295834 3300036401 Bacteria 1530
143 Ga0373937_0335233 3300036401 Bacteria 1432
144 Ga0395905_0157843 3300037471 Unclassified 2133
145 Ga0451835_0627473 3300041492 Bacteria 657
146 Ga0439443_052439 3300042003 Bacteria 716
147 Ga0450890_000227 3300042127 Bacteria 8455
148 Ga0450892_000073 3300042130 Bacteria 11052
149 Ga0439446_0196325 3300042156 Unclassified 680
150 Ga0450893_0000223 3300042532 Bacteria 7575
151 Ga0451577_0107817 3300042876 Bacteria 2490
152 Ga0451577_0133667 3300042876 Bacteria 2227
153 Ga0451577_0802160 3300042876 Unclassified 850
154 Ga0451577_1151985 3300042876 Bacteria 693
155 Ga0451577_1305714 3300042876 Unclassified 645
156 Ga0453683_0837135 3300044673 Unclassified 607
157 Ga0453684_0000643 3300044712 Bacteria 126077
158 Ga0453684_0769071 3300044712 Bacteria 1041
159 Ga0451576_0142754 3300045051 Bacteria 2497
160 Ga0451576_0530218 3300045051 Bacteria 1237
161 Ga0451576_1238972 3300045051 Bacteria 779
162 Ga0495592_0192839 3300046454 Unclassified 1380
163 Ga0495590_0432740 3300046457 Unclassified 507
164 Ga0495586_0489272 3300046535 Bacteria 710
165 Ga0495658_0055623 3300046683 Unclassified 2254
166 Ga0495680_0449011 3300047322 Unclassified 883
167 Ga0495684_0290242 3300047471 Unclassified 1178
168 Ga0501031_0000849 3300049568 Bacteria 18349
169 Ga0501032_0008359 3300049569 Bacteria 7543
170 Ga0501032_0035709 3300049569 Bacteria 3396
171 Ga0501033_0002393 3300049570 Bacteria 15970
172 Ga0501043_0230382 3300049579 Bacteria 1431
173 Ga0501070_0817634 3300049586 Unclassified 731
174 Ga0501083_0300257 3300049744 Bacteria 1044
175 Ga0501035_0016449 3300049822 Bacteria 6822
176 Ga0501044_0001103 3300049823 Bacteria 32118
177 nmdc:mga0n895_904601_c1 3300050512 Bacteria 868
178 Ga0495619_0862946 3300053085 Bacteria 610
179 Ga0500643_106828 3300053087 Bacteria 758
180 Ga0307410_11322056
181 rootH2_10015336
182 rootH2_10209438
183 rootH1_10267389
184 Ga0065704_10617981
185 Ga0070676_10653688
186 Ga0070690_100360733
187 Ga0070690_100569238
188 Ga0070690_101225628
189 Ga0070677_10338278
190 Ga0070689_100046855
191 Ga0070668_100165668
192 Ga0070668_100293264
193 Ga0070668_101041030
194 Ga0070675_100502522
195 Ga0070671_100435864
196 Ga0070674_101028917
197 Ga0070673_102260188
198 Ga0070688_100353467
199 Ga0070688_101590223
200 Ga0070714_100533981
201 Ga0070714_101211495
202 Ga0070713_100072174
203 Ga0070710_10126282
204 Ga0070701_10151953
205 Ga0070711_100252337
206 Ga0070711_101381059
207 Ga0070705_100273522
208 Ga0070708_100127191
209 Ga0070708_100266700
210 Ga0070708_100488901
211 Ga0070708_100507175
212 Ga0070708_101438611
213 Ga0070706_100206283
214 Ga0070706_101114198
215 Ga0070706_101974542
216 Ga0070707_100277964
217 Ga0070707_100592734
218 Ga0070698_100040336
219 Ga0070698_100831080
220 Ga0070699_100503276
221 Ga0070679_101150356
222 Ga0070697_100016626
223 Ga0070697_100025602
224 Ga0070697_100115362
225 Ga0070697_100204642
226 Ga0070686_100177946
227 Ga0070686_101337561
228 Ga0070695_100400124
229 Ga0070704_100567105
230 Ga0070704_100836562
231 Ga0068855_100364695
232 Ga0068859_100902284
233 Ga0068859_101662458
234 Ga0068866_10334540
235 Ga0068863_101516912
236 Ga0068862_100502874
237 Ga0081455_10091453
238 Ga0081538_10036677
239 Ga0070717_10113794
240 Ga0070717_10603872
241 Ga0070716_100095180
242 Ga0070716_100316446
243 Ga0070712_100091306
244 Ga0070712_100150690
245 Ga0097620_100902224
246 Ga0097620_101663126
247 Ga0075435_100480335
248 Ga0099794_10224683
249 Ga0114129_12945291
250 Ga0105243_10386264
251 Ga0105242_12812271
252 Ga0105249_10181241
253 Ga0105249_12304736
254 Ga0105249_13428091
255 Ga0157371_10089098
256 Ga0157370_10554821
257 Ga0157374_10160525
258 Ga0157374_10800141
259 Ga0157378_12052291
260 Ga0157375_12165310
261 Ga0157375_13056264
262 Ga0157375_13480569
263 Ga0163163_11442670
264 Ga0157380_10074861
265 Ga0224572_1073355
266 Ga0207692_10675675
267 Ga0207692_10705024
268 Ga0207642_10077098
269 Ga0207699_10485825
270 Ga0207684_10058343
271 Ga0207684_10275736
272 Ga0207684_11349540
273 Ga0207693_10277989
274 Ga0207693_10546400
275 Ga0207663_10337567
276 Ga0207646_10016824
277 Ga0207646_10507390
278 Ga0207646_10939248
279 Ga0207659_11304274
280 Ga0207664_10039030
281 Ga0207670_10032981
282 Ga0207665_10057538
283 Ga0207712_10628140
284 Ga0207668_10127087
285 Ga0207648_10400669
286 Ga0268265_10468908
287 Ga0265337_1009646
288 Ga0265337_1049921
289 Ga0265326_10091771
290 Ga0265319_1025953
291 Ga0265318_10034594
292 Ga0265322_10080574
293 Ga0265322_10121940
294 Ga0265336_10018162
295 Ga0265336_10173162
296 Ga0265338_10055497
297 Ga0265338_10061795
298 Ga0265338_10068196
299 Ga0265338_10083820
300 Ga0265338_10205292
301 Ga0265338_10217398
302 Ga0265324_10002554
303 Ga0265324_10002694
304 Ga0265328_10103008
305 Ga0265320_10057618
306 Ga0265320_10374080
307 Ga0265339_10142769
308 Ga0265327_10045778
309 Ga0265316_10070125
310 Ga0265314_10000806
311 Ga0307406_10935272
312 Ga0307412_10000040
313 Ga0307412_10092551
314 Ga0307412_11920229
315 Ga0307416_100316366
316 Ga0307414_10866376
317 Ga0307414_12121422
318 Ga0307411_10601878
319 Ga0307411_11195199
320 Ga0373943_0737445
321 Ga0373937_0295834
322 Ga0373937_0335233
323 Ga0395905_0157843
324 Ga0451835_0627473
325 Ga0439443_052439
326 Ga0450890_000227
327 Ga0450892_000073
328 Ga0439446_0196325
329 Ga0450893_0000223
330 Ga0451577_0107817
331 Ga0451577_0133667
332 Ga0451577_0802160
333 Ga0451577_1151985
334 Ga0451577_1305714
335 Ga0453683_0837135
336 Ga0453684_0000643
337 Ga0453684_0769071
338 Ga0451576_0142754
339 Ga0451576_0530218
340 Ga0451576_1238972
341 Ga0495592_0192839
342 Ga0495590_0432740
343 Ga0495586_0489272
344 Ga0495658_0055623
345 Ga0495680_0449011
346 Ga0495684_0290242
347 Ga0501031_0000849
348 Ga0501032_0008359
349 Ga0501032_0035709
350 Ga0501033_0002393
351 Ga0501043_0230382
352 Ga0501070_0817634
353 Ga0501083_0300257
354 Ga0501035_0016449
355 Ga0501044_0001103
356 nmdc:mga0n895_904601_c1
357 Ga0495619_0862946
358 Ga0500643_106828

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map