F274010

General Info

Members Datasets Scaffolds Average Seq Length
179 80 358 208

Family's Representative Sequence

Representative Sequence 3300027526|Ga0209968_1003568|Ga0209968_10035682
Length 227
Sequence MRFTTLFFDLDGTLYSNSTGLWEAIGERMNLYMRDRLGIPEKDVPQLREQYFKMYGTTLRGLQARHGVDVEDFLAFVHDLPLKDYLKPDPIQREIIASLRTRNLIFTNADVNHARRVLDVLKLDDLFEVIVDVNAVSPYCKPMPESFAIAMDLADEPDPRKCVMIDDLSRTTRAALGVGMASLLYGQEEPTSDASGVFTDWNHLPILLGQYGSSLPNKTDRKSFEII

Samples

Sample ID Description Type Environment
1 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
34 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
35 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
42 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
43 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
44 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
45 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
46 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
47 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
48 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
49 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
50 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
51 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
52 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
53 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
54 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
55 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
56 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
57 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
58 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
59 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
60 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
61 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
63 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
64 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
65 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
66 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
67 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
68 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
69 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
70 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
71 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
72 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
73 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
74 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
75 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
76 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
77 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
78 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
79 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
80 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.12
Rhizosphere 98.88
Stem 0
Stem Tuber 0
Unclassified 24.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209968_1003568 3300027526 Unclassified 2333
2 SwRhRL2b_contig_1401420 2162886007 Bacteria 8114
3 JGI25406J46586_10032852 3300003203 Bacteria 1923
4 JGI25406J46586_10051543 3300003203 Bacteria 1376
5 Ga0065704_10071469 3300005289 Bacteria 11005
6 Ga0065715_10298864 3300005293 Unclassified 1046
7 Ga0065707_10000467 3300005295 Bacteria 75943
8 Ga0065707_10084377 3300005295 Bacteria 7266
9 Ga0065707_10088253 3300005295 Bacteria 4720
10 Ga0065707_10164518 3300005295 Bacteria 1534
11 Ga0065707_10212354 3300005295 Bacteria 1260
12 Ga0065707_10248920 3300005295 Bacteria 1122
13 Ga0070692_10374623 3300005345 Bacteria 891
14 Ga0070700_100041966 3300005441 Bacteria 2807
15 Ga0070685_10759400 3300005466 Unclassified 712
16 Ga0070706_100527230 3300005467 Bacteria 1099
17 Ga0070707_100574356 3300005468 Bacteria 1090
18 Ga0070698_100025772 3300005471 Bacteria 6127
19 Ga0070698_100236834 3300005471 Unclassified 1758
20 Ga0070698_100265479 3300005471 Unclassified 1648
21 Ga0070698_100520862 3300005471 Bacteria 1127
22 Ga0070699_100005854 3300005518 Bacteria 10741
23 Ga0070699_100253567 3300005518 Bacteria 1572
24 Ga0070699_100439764 3300005518 Bacteria 1182
25 Ga0070695_100076962 3300005545 Unclassified 2198
26 Ga0070695_100144269 3300005545 Bacteria 1655
27 Ga0070696_100566885 3300005546 Bacteria 912
28 Ga0070704_100254219 3300005549 Bacteria 1445
29 Ga0070704_100543896 3300005549 Unclassified 1014
30 Ga0068859_100011918 3300005617 Bacteria 8735
31 Ga0068870_10080834 3300005840 Unclassified 1796
32 Ga0068858_100461800 3300005842 Bacteria 1224
33 Ga0068862_100044542 3300005844 Unclassified 3785
34 Ga0068862_100111526 3300005844 Bacteria 2401
35 Ga0081539_10001365 3300005985 Bacteria 42287
36 Ga0075428_100012799 3300006844 Bacteria 9330
37 Ga0075428_100241223 3300006844 Archaea 1950
38 Ga0075428_100261562 3300006844 Bacteria 1863
39 Ga0075430_100065237 3300006846 Bacteria 3059
40 Ga0075430_100157840 3300006846 Archaea 1888
41 Ga0075431_100013372 3300006847 Bacteria 8293
42 Ga0075431_100031477 3300006847 Bacteria 5464
43 Ga0075431_100032986 3300006847 Bacteria 5337
44 Ga0075433_10377875 3300006852 Bacteria 1251
45 Ga0075434_100159491 3300006871 Bacteria 2276
46 Ga0075429_100000744 3300006880 Bacteria 25586
47 Ga0075429_100039697 3300006880 Bacteria 4096
48 Ga0075429_100083050 3300006880 Unclassified 2793
49 Ga0075429_100123597 3300006880 Bacteria 2263
50 Ga0097620_100011919 3300006931 Bacteria 8735
51 Ga0097620_100071886 3300006931 Unclassified 3495
52 Ga0097620_100184654 3300006931 Bacteria 2169
53 Ga0114129_10013806 3300009147 Bacteria 11506
54 Ga0114129_10041667 3300009147 Bacteria 6468
55 Ga0114129_10300389 3300009147 Bacteria 2140
56 Ga0114129_10481632 3300009147 Bacteria 1623
57 Ga0114129_10910626 3300009147 Bacteria 1114
58 Ga0105243_10043419 3300009148 Unclassified 3523
59 Ga0105242_10313701 3300009176 Bacteria 1436
60 Ga0105249_10252164 3300009553 Bacteria 1750
61 Ga0105246_10029532 3300011119 Bacteria 3612
62 Ga0105246_10038276 3300011119 Bacteria 3223
63 Ga0157380_10865370 3300014326 Unclassified 927
64 Ga0207643_10124021 3300025908 Bacteria 1532
65 Ga0207684_10223375 3300025910 Bacteria 1625
66 Ga0207646_10372424 3300025922 Bacteria 1290
67 Ga0207709_10239977 3300025935 Bacteria 1318
68 Ga0207708_10062075 3300026075 Bacteria 2854
69 Ga0207708_10404851 3300026075 Unclassified 1129
70 Ga0207675_100149747 3300026118 Bacteria 2220
71 Ga0316575_10001317 3300031665 Bacteria 7930
72 Ga0316579_10007641 3300031691 Bacteria 4473
73 Ga0316579_10072783 3300031691 Unclassified 1630
74 Ga0316576_10218357 3300031727 Bacteria 1435
75 Ga0316576_10333608 3300031727 Bacteria 1130
76 Ga0316578_10041331 3300031728 Bacteria 2670
77 Ga0316578_10080515 3300031728 Unclassified 1937
78 Ga0316577_10001144 3300031733 Bacteria 12141
79 Ga0316577_10330262 3300031733 Unclassified 865
80 Ga0307410_10269789 3300031852 Bacteria 1331
81 Ga0307416_100678357 3300032002 Bacteria 1118
82 Ga0316582_0000586 3300036647 Bacteria 14074
83 Ga0316582_0619517 3300036647 Unclassified 744
84 Ga0316584_0000583 3300036712 Bacteria 19728
85 Ga0316584_0099209 3300036712 Unclassified 2181
86 Ga0316584_0447558 3300036712 Unclassified 914
87 Ga0316581_0002873 3300037588 Bacteria 4218
88 Ga0316581_0040425 3300037588 Unclassified 1420
89 Ga0451577_0000735 3300042876 Bacteria 50706
90 Ga0451577_0012309 3300042876 Bacteria 8035
91 Ga0451577_0013107 3300042876 Bacteria 7771
92 Ga0451577_0100648 3300042876 Bacteria 2582
93 Ga0451577_0129013 3300042876 Bacteria 2267
94 Ga0451577_0133533 3300042876 Bacteria 2228
95 Ga0451577_1352280 3300042876 Bacteria 633
96 Ga0453683_0000663 3300044673 Bacteria 36826
97 Ga0453683_0024436 3300044673 Bacteria 3844
98 Ga0453683_0031542 3300044673 Bacteria 3348
99 Ga0453683_0039128 3300044673 Bacteria 2980
100 Ga0453683_0147751 3300044673 Bacteria 1484
101 Ga0453683_0213436 3300044673 Bacteria 1226
102 Ga0453684_0000232 3300044712 Bacteria 240951
103 Ga0453684_0000505 3300044712 Bacteria 152407
104 Ga0453684_0002638 3300044712 Bacteria 42867
105 Ga0453684_0004914 3300044712 Bacteria 27317
106 Ga0453684_0006031 3300044712 Bacteria 23448
107 Ga0453684_0053294 3300044712 Bacteria 5281
108 Ga0453684_0056437 3300044712 Bacteria 5094
109 Ga0453684_0069968 3300044712 Bacteria 4447
110 Ga0453684_0078324 3300044712 Bacteria 4136
111 Ga0453684_0083187 3300044712 Bacteria 3984
112 Ga0453684_0087093 3300044712 Bacteria 3872
113 Ga0453684_0094996 3300044712 Bacteria 3665
114 Ga0453684_0110155 3300044712 Bacteria 3347
115 Ga0453684_0128595 3300044712 Bacteria 3043
116 Ga0453684_0180678 3300044712 Bacteria 2477
117 Ga0453684_0193821 3300044712 Bacteria 2374
118 Ga0453684_0216904 3300044712 Bacteria 2219
119 Ga0453684_0225952 3300044712 Bacteria 2164
120 Ga0453684_0249084 3300044712 Unclassified 2041
121 Ga0453684_0267952 3300044712 Bacteria 1953
122 Ga0453684_0269293 3300044712 Bacteria 1947
123 Ga0453684_0289427 3300044712 Bacteria 1866
124 Ga0453684_0364229 3300044712 Bacteria 1627
125 Ga0453684_0530210 3300044712 Unclassified 1300
126 Ga0453684_1036880 3300044712 Unclassified 870
127 Ga0451576_0004056 3300045051 Bacteria 19413
128 Ga0451576_0006113 3300045051 Bacteria 14836
129 Ga0451576_0025177 3300045051 Bacteria 6415
130 Ga0451576_0256323 3300045051 Bacteria 1828
131 Ga0451576_0826671 3300045051 Bacteria 972
132 Ga0451576_1733677 3300045051 Unclassified 646
133 Ga0496108_0085309 3300048911 Unclassified 2680
134 Ga0496111_0620430 3300048914 Unclassified 791
135 Ga0501031_0679339 3300049568 Unclassified 661
136 Ga0501038_0585926 3300049574 Unclassified 845
137 Ga0501039_0220919 3300049575 Bacteria 1490
138 Ga0501039_0233547 3300049575 Bacteria 1446
139 Ga0501040_1116947 3300049576 Unclassified 572
140 Ga0501043_0433593 3300049579 Bacteria 990
141 Ga0501071_0389664 3300049587 Unclassified 1063
142 Ga0501071_0471451 3300049587 Unclassified 962
143 Ga0501072_0154145 3300049588 Bacteria 1832
144 Ga0501074_0365108 3300049590 Bacteria 1024
145 Ga0501075_0001828 3300049591 Bacteria 14031
146 Ga0501075_0436613 3300049591 Unclassified 998
147 Ga0501076_0070938 3300049592 Bacteria 2786
148 Ga0501076_0071154 3300049592 Unclassified 2782
149 Ga0501076_0155098 3300049592 Bacteria 1864
150 Ga0501077_0219041 3300049593 Bacteria 1210
151 Ga0501227_046016 3300049665 Unclassified 1090
152 Ga0501079_0519381 3300049741 Bacteria 936
153 Ga0501080_0207603 3300049742 Unclassified 1796
154 Ga0501080_0654881 3300049742 Unclassified 929
155 Ga0501081_0030772 3300049743 Bacteria 3635
156 Ga0501045_0048586 3300049824 Bacteria 3093
157 Ga0501045_0352655 3300049824 Unclassified 1095
158 nmdc:mga05p37_1919_c1 3300050507 Bacteria 24182
159 nmdc:mga05p37_317001_c1 3300050507 Bacteria 1847
160 nmdc:mga05p37_332816_c1 3300050507 Unclassified 1793
161 nmdc:mga05p37_4317_c1 3300050507 Bacteria 16611
162 nmdc:mga05p37_652605_c1 3300050507 Unclassified 1178
163 nmdc:mga05p37_759664_c1 3300050507 Unclassified 1067
164 nmdc:mga05p37_8285_c1 3300050507 Bacteria 12290
165 nmdc:mga09592_1022_c1 3300050508 Bacteria 22217
166 nmdc:mga09592_368187_c1 3300050508 Unclassified 1243
167 nmdc:mga09592_52979_c1 3300050508 Bacteria 3425
168 nmdc:mga09592_53288_c1 3300050508 Bacteria 3416
169 nmdc:mga09592_87998_c1 3300050508 Bacteria 2652
170 nmdc:mga0qj67_14470_c1 3300050509 Bacteria 5964
171 nmdc:mga06r32_163794_c1 3300050510 Bacteria 2206
172 nmdc:mga06r32_66648_c1 3300050510 Bacteria 3474
173 nmdc:mga0n895_304971_c1 3300050512 Bacteria 1614
174 nmdc:mga0a205_284734_c1 3300050515 Bacteria 1528
175 nmdc:mga0a205_810668_c1 3300050515 Bacteria 784
176 nmdc:mga0a205_939726_c1 3300050515 Unclassified 711
177 Ga0501084_0152101 3300054114 Bacteria 1951
178 Ga0501084_0463216 3300054114 Bacteria 1072
179 Ga0530510_0293150 3300061734 Bacteria 1217
180 Ga0209968_1003568
181 SwRhRL2b_contig_1401420
182 JGI25406J46586_10032852
183 JGI25406J46586_10051543
184 Ga0065704_10071469
185 Ga0065715_10298864
186 Ga0065707_10000467
187 Ga0065707_10084377
188 Ga0065707_10088253
189 Ga0065707_10164518
190 Ga0065707_10212354
191 Ga0065707_10248920
192 Ga0070692_10374623
193 Ga0070700_100041966
194 Ga0070685_10759400
195 Ga0070706_100527230
196 Ga0070707_100574356
197 Ga0070698_100025772
198 Ga0070698_100236834
199 Ga0070698_100265479
200 Ga0070698_100520862
201 Ga0070699_100005854
202 Ga0070699_100253567
203 Ga0070699_100439764
204 Ga0070695_100076962
205 Ga0070695_100144269
206 Ga0070696_100566885
207 Ga0070704_100254219
208 Ga0070704_100543896
209 Ga0068859_100011918
210 Ga0068870_10080834
211 Ga0068858_100461800
212 Ga0068862_100044542
213 Ga0068862_100111526
214 Ga0081539_10001365
215 Ga0075428_100012799
216 Ga0075428_100241223
217 Ga0075428_100261562
218 Ga0075430_100065237
219 Ga0075430_100157840
220 Ga0075431_100013372
221 Ga0075431_100031477
222 Ga0075431_100032986
223 Ga0075433_10377875
224 Ga0075434_100159491
225 Ga0075429_100000744
226 Ga0075429_100039697
227 Ga0075429_100083050
228 Ga0075429_100123597
229 Ga0097620_100011919
230 Ga0097620_100071886
231 Ga0097620_100184654
232 Ga0114129_10013806
233 Ga0114129_10041667
234 Ga0114129_10300389
235 Ga0114129_10481632
236 Ga0114129_10910626
237 Ga0105243_10043419
238 Ga0105242_10313701
239 Ga0105249_10252164
240 Ga0105246_10029532
241 Ga0105246_10038276
242 Ga0157380_10865370
243 Ga0207643_10124021
244 Ga0207684_10223375
245 Ga0207646_10372424
246 Ga0207709_10239977
247 Ga0207708_10062075
248 Ga0207708_10404851
249 Ga0207675_100149747
250 Ga0316575_10001317
251 Ga0316579_10007641
252 Ga0316579_10072783
253 Ga0316576_10218357
254 Ga0316576_10333608
255 Ga0316578_10041331
256 Ga0316578_10080515
257 Ga0316577_10001144
258 Ga0316577_10330262
259 Ga0307410_10269789
260 Ga0307416_100678357
261 Ga0316582_0000586
262 Ga0316582_0619517
263 Ga0316584_0000583
264 Ga0316584_0099209
265 Ga0316584_0447558
266 Ga0316581_0002873
267 Ga0316581_0040425
268 Ga0451577_0000735
269 Ga0451577_0012309
270 Ga0451577_0013107
271 Ga0451577_0100648
272 Ga0451577_0129013
273 Ga0451577_0133533
274 Ga0451577_1352280
275 Ga0453683_0000663
276 Ga0453683_0024436
277 Ga0453683_0031542
278 Ga0453683_0039128
279 Ga0453683_0147751
280 Ga0453683_0213436
281 Ga0453684_0000232
282 Ga0453684_0000505
283 Ga0453684_0002638
284 Ga0453684_0004914
285 Ga0453684_0006031
286 Ga0453684_0053294
287 Ga0453684_0056437
288 Ga0453684_0069968
289 Ga0453684_0078324
290 Ga0453684_0083187
291 Ga0453684_0087093
292 Ga0453684_0094996
293 Ga0453684_0110155
294 Ga0453684_0128595
295 Ga0453684_0180678
296 Ga0453684_0193821
297 Ga0453684_0216904
298 Ga0453684_0225952
299 Ga0453684_0249084
300 Ga0453684_0267952
301 Ga0453684_0269293
302 Ga0453684_0289427
303 Ga0453684_0364229
304 Ga0453684_0530210
305 Ga0453684_1036880
306 Ga0451576_0004056
307 Ga0451576_0006113
308 Ga0451576_0025177
309 Ga0451576_0256323
310 Ga0451576_0826671
311 Ga0451576_1733677
312 Ga0496108_0085309
313 Ga0496111_0620430
314 Ga0501031_0679339
315 Ga0501038_0585926
316 Ga0501039_0220919
317 Ga0501039_0233547
318 Ga0501040_1116947
319 Ga0501043_0433593
320 Ga0501071_0389664
321 Ga0501071_0471451
322 Ga0501072_0154145
323 Ga0501074_0365108
324 Ga0501075_0001828
325 Ga0501075_0436613
326 Ga0501076_0070938
327 Ga0501076_0071154
328 Ga0501076_0155098
329 Ga0501077_0219041
330 Ga0501227_046016
331 Ga0501079_0519381
332 Ga0501080_0207603
333 Ga0501080_0654881
334 Ga0501081_0030772
335 Ga0501045_0048586
336 Ga0501045_0352655
337 nmdc:mga05p37_1919_c1
338 nmdc:mga05p37_317001_c1
339 nmdc:mga05p37_332816_c1
340 nmdc:mga05p37_4317_c1
341 nmdc:mga05p37_652605_c1
342 nmdc:mga05p37_759664_c1
343 nmdc:mga05p37_8285_c1
344 nmdc:mga09592_1022_c1
345 nmdc:mga09592_368187_c1
346 nmdc:mga09592_52979_c1
347 nmdc:mga09592_53288_c1
348 nmdc:mga09592_87998_c1
349 nmdc:mga0qj67_14470_c1
350 nmdc:mga06r32_163794_c1
351 nmdc:mga06r32_66648_c1
352 nmdc:mga0n895_304971_c1
353 nmdc:mga0a205_284734_c1
354 nmdc:mga0a205_810668_c1
355 nmdc:mga0a205_939726_c1
356 Ga0501084_0152101
357 Ga0501084_0463216
358 Ga0530510_0293150

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

6

185

0.85

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

3

179

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ef7-assembly1.cif.gz_A crystal structure of xanthosine monophosphate phosphatase complex with xmp 0.9174 2 205
7ef6-assembly1.cif.gz_A crystal structure of xanthosine monophosphate phosphatase in the unliganded state 0.9003 2 205
7ef7-assembly1.cif.gz_A crystal structure of xanthosine monophosphate phosphatase complex with xmp 0.8886 2 205
3opx-assembly1.cif.gz_A crystal structure of pyrimidine 5 -nucleotidase sdt1 from saccharomyces cerevisiae complexed with uridine 5'-monophosphate 0.8718 3 210
7ef6-assembly1.cif.gz_A crystal structure of xanthosine monophosphate phosphatase in the unliganded state 0.8718 2 205
ID Description Score Start End Superfamily
3opxA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; 0.9416 17 83 1.10.150.450
af_Q9SKY5_89_234_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9371 87 205 3.40.50.1000
af_Q54B74_103_232_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9335 85 207 3.40.50.1000
af_K7KDK8_16_102_3.30.70.1620 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9223 8 84 3.30.70.1620
af_I1LQN9_94_263_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.922 80 206 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A363U1X2-F1-model_v4 Pyrimidine 5'-nucleotidase 0.9752 1 210
AF-A0A3N5RDR2-F1-model_v4 Pyrimidine 5'-nucleotidase 0.9744 1 137
AF-A0A1F8PHV5-F1-model_v4 Pyrimidine 5'-nucleotidase 0.9653 2 151
AF-A0A7S0BCG4-F1-model_v4 Pyrimidine 5'-nucleotidase 0.9613 3 170
AF-A0A3N5RDR2-F1-model_v4 Pyrimidine 5'-nucleotidase 0.9606 1 137

Map