F273545

General Info

Members Datasets Scaffolds Average Seq Length
179 138 358 135

Family's Representative Sequence

Representative Sequence 3300005719|Ga0068861_101747251|Ga0068861_1017472511
Length 157
Sequence MSAPVVSSVRVVVVMASSVYHMAKSSAQQDESASQLIDARVEELGDWRGKTLARVRALIKQADPEVVEEWKWRKASNPGVPVWSHEGGICTGETYKSAVKLTFFKGASLDDPSGLFNASLEGNTRRAIDFHEGDEIDEKAFVALIQAAVSLNESSSR

Samples

Sample ID Description Type Environment
1 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
11 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
16 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
27 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
43 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
65 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
66 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
67 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
68 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
69 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
70 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
71 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
72 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
73 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
74 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
75 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
76 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
77 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
78 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
79 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
80 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
81 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
82 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
83 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
84 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
85 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
86 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
87 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
88 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
89 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
90 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
91 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
92 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
93 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
94 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
95 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
96 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
97 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
98 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
99 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
100 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
101 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
102 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
103 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
104 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
105 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
106 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
107 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
108 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
109 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
110 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
113 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
114 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
115 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
116 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
117 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
118 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
119 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
120 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
121 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
122 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
123 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
124 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
125 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
127 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
128 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
129 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
134 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
135 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
136 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
137 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
138 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.12
Nodule 0
Rhizoplane 13.97
Rhizosphere 82.12
Stem 0
Stem Tuber 0
Unclassified 0.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068861_101747251 3300005719 Bacteria 616
2 Ga0070680_102009306 3300005336 Bacteria 501
3 Ga0070659_100573007 3300005366 Bacteria 968
4 Ga0070709_10079396 3300005434 Bacteria 2137
5 Ga0070714_100169529 3300005435 Bacteria 1980
6 Ga0070714_100947607 3300005435 Bacteria 837
7 Ga0070713_100032349 3300005436 Bacteria 4176
8 Ga0070713_100099286 3300005436 Bacteria 2518
9 Ga0070710_11109407 3300005437 Bacteria 581
10 Ga0070711_100070331 3300005439 Bacteria 2464
11 Ga0070679_100454729 3300005530 Bacteria 1225
12 Ga0070697_100097917 3300005536 Bacteria 2434
13 Ga0070704_100226844 3300005549 Bacteria 1521
14 Ga0068855_100274790 3300005563 Bacteria 1872
15 Ga0068854_100360401 3300005578 Bacteria 1193
16 Ga0068856_100216462 3300005614 Bacteria 1931
17 Ga0068856_102280189 3300005614 Bacteria 550
18 Ga0068866_10103867 3300005718 Bacteria 1573
19 Ga0068866_10208235 3300005718 Bacteria 1172
20 Ga0068861_100421174 3300005719 Bacteria 1190
21 Ga0068858_100000004 3300005842 Bacteria 336234
22 Ga0068860_101535734 3300005843 Bacteria 688
23 Ga0081455_10106052 3300005937 Bacteria 2244
24 Ga0081455_10839061 3300005937 Bacteria 575
25 Ga0081539_10009756 3300005985 Bacteria 7942
26 Ga0070717_11215878 3300006028 Bacteria 686
27 Ga0070716_100678882 3300006173 Bacteria 784
28 Ga0070712_100005166 3300006175 Bacteria 8076
29 Ga0075366_10030619 3300006195 Bacteria 3164
30 Ga0075428_100304167 3300006844 Bacteria 1714
31 Ga0075430_100141246 3300006846 Bacteria 2006
32 Ga0075436_100030167 3300006914 Bacteria 3731
33 Ga0075436_100335407 3300006914 Bacteria 1088
34 Ga0075435_100035666 3300007076 Bacteria 3947
35 Ga0075435_100211474 3300007076 Bacteria 1646
36 Ga0075435_100577567 3300007076 Bacteria 974
37 Ga0111539_10522743 3300009094 Bacteria 1382
38 Ga0111539_11641635 3300009094 Bacteria 745
39 Ga0105245_11499532 3300009098 Bacteria 725
40 Ga0114129_10316767 3300009147 Bacteria 2074
41 Ga0114129_10357837 3300009147 Bacteria 1932
42 Ga0105243_11681465 3300009148 Bacteria 663
43 Ga0105242_10124708 3300009176 Bacteria 2215
44 Ga0105248_10000241 3300009177 Bacteria 63198
45 Ga0105248_11788334 3300009177 Bacteria 697
46 Ga0105237_10773267 3300009545 Bacteria 967
47 Ga0105238_11231002 3300009551 Bacteria 773
48 Ga0105249_10007650 3300009553 Bacteria 9418
49 Ga0105249_11401515 3300009553 Bacteria 771
50 Ga0105249_11426018 3300009553 Bacteria 764
51 Ga0105239_11591748 3300010375 Bacteria 755
52 Ga0157369_11582490 3300013105 Bacteria 666
53 Ga0157378_10313172 3300013297 Bacteria 1523
54 Ga0157378_11911481 3300013297 Bacteria 643
55 Ga0157378_12426034 3300013297 Bacteria 576
56 Ga0157379_10000001 3300014968 Bacteria 180484
57 Ga0157376_12624518 3300014969 Bacteria 544
58 Ga0213876_10021004 3300021384 Bacteria 3453
59 Ga0207692_10763913 3300025898 Bacteria 630
60 Ga0207688_10330799 3300025901 Bacteria 936
61 Ga0207699_10115857 3300025906 Bacteria 1725
62 Ga0207684_11538812 3300025910 Bacteria 540
63 Ga0207693_10013489 3300025915 Bacteria 6585
64 Ga0207663_10046165 3300025916 Bacteria 2683
65 Ga0207687_11003694 3300025927 Bacteria 716
66 Ga0207700_10287648 3300025928 Bacteria 1416
67 Ga0207700_10320836 3300025928 Bacteria 1342
68 Ga0207664_10191243 3300025929 Bacteria 1762
69 Ga0207686_10290485 3300025934 Bacteria 1210
70 Ga0207711_10002279 3300025941 Bacteria 17225
71 Ga0207667_10205708 3300025949 Bacteria 2018
72 Ga0207712_10363186 3300025961 Bacteria 1207
73 Ga0207677_10037758 3300026023 Bacteria 3160
74 Ga0207703_10000011 3300026035 Bacteria 336248
75 Ga0207678_11215544 3300026067 Bacteria 667
76 Ga0207708_10179114 3300026075 Bacteria 1683
77 Ga0207702_10110900 3300026078 Bacteria 2439
78 Ga0207702_10456828 3300026078 Bacteria 1240
79 Ga0207675_100044444 3300026118 Bacteria 4151
80 Ga0268265_12656452 3300028380 Bacteria 506
81 Ga0268264_10994372 3300028381 Bacteria 845
82 Ga0265338_10032600 3300028800 Bacteria 5075
83 Ga0265327_10005470 3300031251 Bacteria 10592
84 Ga0265327_10020894 3300031251 Bacteria 3970
85 Ga0265316_10263527 3300031344 Bacteria 1263
86 Ga0373953_0185273 3300035117 Bacteria 899
87 Ga0373955_0267746 3300035172 Bacteria 1027
88 Ga0373924_0162998 3300035410 Bacteria 978
89 Ga0373927_0238542 3300035695 Bacteria 1195
90 Ga0373947_0453961 3300035725 Bacteria 868
91 Ga0395900_0020382 3300037418 Bacteria 6768
92 Ga0395900_0378933 3300037418 Bacteria 1383
93 Ga0395898_0004846 3300037466 Bacteria 14623
94 Ga0395905_0024737 3300037471 Bacteria 5667
95 Ga0395905_0071920 3300037471 Bacteria 3242
96 Ga0395905_0557012 3300037471 Bacteria 1048
97 Ga0395905_0942743 3300037471 Bacteria 766
98 Ga0395901_0013724 3300038443 Bacteria 8233
99 Ga0395901_0021200 3300038443 Bacteria 6655
100 Ga0395901_0038050 3300038443 Bacteria 4976
101 Ga0395901_0285773 3300038443 Bacteria 1713
102 Ga0395901_1140433 3300038443 Bacteria 748
103 Ga0242420_013522 3300038996 Bacteria 1392
104 Ga0436365_1456482 3300039437 Bacteria 55413
105 Ga0451789_0448336 3300041443 Bacteria 712
106 Ga0451802_0228760 3300041460 Bacteria 534
107 Ga0451853_0516119 3300041512 Bacteria 1097
108 Ga0451853_3731553 3300041512 Bacteria 764
109 Ga0466966_0043358 3300044684 Bacteria 2884
110 Ga0466957_1387158 3300044842 Bacteria 511
111 Ga0466958_0043122 3300045836 Bacteria 2716
112 Ga0466967_0708341 3300045976 Bacteria 997
113 Ga0495592_0191135 3300046454 Bacteria 1387
114 Ga0495603_0249460 3300046455 Bacteria 1022
115 Ga0495641_0080651 3300046461 Bacteria 1458
116 Ga0495651_0010807 3300046462 Bacteria 7018
117 Ga0495651_0348207 3300046462 Bacteria 980
118 Ga0495653_0087717 3300046463 Bacteria 2284
119 Ga0495584_0185573 3300046491 Bacteria 1057
120 Ga0495608_0010612 3300046511 Bacteria 6428
121 Ga0495618_0108911 3300046514 Bacteria 1774
122 Ga0495628_0185715 3300046516 Bacteria 1571
123 Ga0495628_0582261 3300046516 Bacteria 801
124 Ga0495630_0942511 3300046517 Bacteria 657
125 Ga0495640_0163882 3300046533 Bacteria 1423
126 Ga0495587_0070864 3300046536 Bacteria 2028
127 Ga0495645_0806246 3300046543 Bacteria 563
128 Ga0495667_0108396 3300046559 Bacteria 1794
129 Ga0495634_0266002 3300046642 Bacteria 1045
130 Ga0495657_0004708 3300046675 Bacteria 10872
131 Ga0495646_0119302 3300046680 Bacteria 1494
132 Ga0495613_0253038 3300046689 Bacteria 1229
133 Ga0495581_0451487 3300047315 Bacteria 749
134 Ga0495674_0357683 3300047319 Bacteria 1184
135 Ga0495674_0712773 3300047319 Bacteria 787
136 Ga0495680_0011087 3300047322 Bacteria 8001
137 Ga0495675_0089445 3300047444 Bacteria 1933
138 Ga0495684_0079627 3300047471 Bacteria 2487
139 Ga0495593_0091537 3300047673 Bacteria 1566
140 Ga0495602_0014079 3300048088 Bacteria 8134
141 Ga0496100_0001811 3300048903 Bacteria 10672
142 Ga0496100_0072298 3300048903 Bacteria 2305
143 Ga0496102_0012046 3300048905 Bacteria 7474
144 Ga0496102_0202816 3300048905 Bacteria 1870
145 Ga0496102_1343860 3300048905 Bacteria 634
146 Ga0496104_0029342 3300048907 Bacteria 5101
147 Ga0496105_0017215 3300048908 Bacteria 5790
148 Ga0496105_0102481 3300048908 Bacteria 2364
149 Ga0496105_0299352 3300048908 Bacteria 1293
150 Ga0496106_0620402 3300048909 Bacteria 865
151 Ga0496107_0076470 3300048910 Bacteria 2438
152 Ga0496108_0000699 3300048911 Bacteria 26051
153 Ga0496108_0175379 3300048911 Bacteria 1856
154 Ga0496109_0042312 3300048912 Bacteria 4125
155 Ga0496110_0000964 3300048913 Bacteria 20143
156 Ga0496110_0989867 3300048913 Bacteria 748
157 Ga0496111_0000257 3300048914 Bacteria 25776
158 Ga0496112_0002195 3300048915 Bacteria 15543
159 Ga0496112_0236853 3300048915 Bacteria 1779
160 Ga0496113_0018414 3300048916 Bacteria 4863
161 Ga0496114_0204828 3300048917 Bacteria 1729
162 Ga0496115_0023503 3300048918 Bacteria 4783
163 Ga0496115_0599169 3300048918 Bacteria 876
164 Ga0496116_0000617 3300048919 Bacteria 46842
165 Ga0501040_0143485 3300049576 Bacteria 1683
166 Ga0501076_0449654 3300049592 Bacteria 1061
167 nmdc:mga0k408_56686_c1 3300050493 Unclassified 2274
168 nmdc:mga05p37_143944_c1 3300050507 Bacteria 2919
169 nmdc:mga09592_93229_c1 3300050508 Bacteria 2575
170 nmdc:mga0qj67_349084_c1 3300050509 Bacteria 1196
171 nmdc:mga08y16_1010049_c1 3300050511 Bacteria 811
172 nmdc:mga0n895_227037_c1 3300050512 Bacteria 1895
173 nmdc:mga0rr50_13792_c1 3300050513 Bacteria 5276
174 nmdc:mga08x19_432736_c1 3300050514 Bacteria 925
175 nmdc:mga08x19_64523_c1 3300050514 Bacteria 2377
176 nmdc:mga0a205_765359_c1 3300050515 Bacteria 814
177 Ga0495601_0645686 3300053077 Bacteria 677
178 Ga0495595_0077403 3300053084 Bacteria 1580
179 Ga0530510_0209859 3300061734 Bacteria 1447
180 Ga0068861_101747251
181 Ga0070680_102009306
182 Ga0070659_100573007
183 Ga0070709_10079396
184 Ga0070714_100169529
185 Ga0070714_100947607
186 Ga0070713_100032349
187 Ga0070713_100099286
188 Ga0070710_11109407
189 Ga0070711_100070331
190 Ga0070679_100454729
191 Ga0070697_100097917
192 Ga0070704_100226844
193 Ga0068855_100274790
194 Ga0068854_100360401
195 Ga0068856_100216462
196 Ga0068856_102280189
197 Ga0068866_10103867
198 Ga0068866_10208235
199 Ga0068861_100421174
200 Ga0068858_100000004
201 Ga0068860_101535734
202 Ga0081455_10106052
203 Ga0081455_10839061
204 Ga0081539_10009756
205 Ga0070717_11215878
206 Ga0070716_100678882
207 Ga0070712_100005166
208 Ga0075366_10030619
209 Ga0075428_100304167
210 Ga0075430_100141246
211 Ga0075436_100030167
212 Ga0075436_100335407
213 Ga0075435_100035666
214 Ga0075435_100211474
215 Ga0075435_100577567
216 Ga0111539_10522743
217 Ga0111539_11641635
218 Ga0105245_11499532
219 Ga0114129_10316767
220 Ga0114129_10357837
221 Ga0105243_11681465
222 Ga0105242_10124708
223 Ga0105248_10000241
224 Ga0105248_11788334
225 Ga0105237_10773267
226 Ga0105238_11231002
227 Ga0105249_10007650
228 Ga0105249_11401515
229 Ga0105249_11426018
230 Ga0105239_11591748
231 Ga0157369_11582490
232 Ga0157378_10313172
233 Ga0157378_11911481
234 Ga0157378_12426034
235 Ga0157379_10000001
236 Ga0157376_12624518
237 Ga0213876_10021004
238 Ga0207692_10763913
239 Ga0207688_10330799
240 Ga0207699_10115857
241 Ga0207684_11538812
242 Ga0207693_10013489
243 Ga0207663_10046165
244 Ga0207687_11003694
245 Ga0207700_10287648
246 Ga0207700_10320836
247 Ga0207664_10191243
248 Ga0207686_10290485
249 Ga0207711_10002279
250 Ga0207667_10205708
251 Ga0207712_10363186
252 Ga0207677_10037758
253 Ga0207703_10000011
254 Ga0207678_11215544
255 Ga0207708_10179114
256 Ga0207702_10110900
257 Ga0207702_10456828
258 Ga0207675_100044444
259 Ga0268265_12656452
260 Ga0268264_10994372
261 Ga0265338_10032600
262 Ga0265327_10005470
263 Ga0265327_10020894
264 Ga0265316_10263527
265 Ga0373953_0185273
266 Ga0373955_0267746
267 Ga0373924_0162998
268 Ga0373927_0238542
269 Ga0373947_0453961
270 Ga0395900_0020382
271 Ga0395900_0378933
272 Ga0395898_0004846
273 Ga0395905_0024737
274 Ga0395905_0071920
275 Ga0395905_0557012
276 Ga0395905_0942743
277 Ga0395901_0013724
278 Ga0395901_0021200
279 Ga0395901_0038050
280 Ga0395901_0285773
281 Ga0395901_1140433
282 Ga0242420_013522
283 Ga0436365_1456482
284 Ga0451789_0448336
285 Ga0451802_0228760
286 Ga0451853_0516119
287 Ga0451853_3731553
288 Ga0466966_0043358
289 Ga0466957_1387158
290 Ga0466958_0043122
291 Ga0466967_0708341
292 Ga0495592_0191135
293 Ga0495603_0249460
294 Ga0495641_0080651
295 Ga0495651_0010807
296 Ga0495651_0348207
297 Ga0495653_0087717
298 Ga0495584_0185573
299 Ga0495608_0010612
300 Ga0495618_0108911
301 Ga0495628_0185715
302 Ga0495628_0582261
303 Ga0495630_0942511
304 Ga0495640_0163882
305 Ga0495587_0070864
306 Ga0495645_0806246
307 Ga0495667_0108396
308 Ga0495634_0266002
309 Ga0495657_0004708
310 Ga0495646_0119302
311 Ga0495613_0253038
312 Ga0495581_0451487
313 Ga0495674_0357683
314 Ga0495674_0712773
315 Ga0495680_0011087
316 Ga0495675_0089445
317 Ga0495684_0079627
318 Ga0495593_0091537
319 Ga0495602_0014079
320 Ga0496100_0001811
321 Ga0496100_0072298
322 Ga0496102_0012046
323 Ga0496102_0202816
324 Ga0496102_1343860
325 Ga0496104_0029342
326 Ga0496105_0017215
327 Ga0496105_0102481
328 Ga0496105_0299352
329 Ga0496106_0620402
330 Ga0496107_0076470
331 Ga0496108_0000699
332 Ga0496108_0175379
333 Ga0496109_0042312
334 Ga0496110_0000964
335 Ga0496110_0989867
336 Ga0496111_0000257
337 Ga0496112_0002195
338 Ga0496112_0236853
339 Ga0496113_0018414
340 Ga0496114_0204828
341 Ga0496115_0023503
342 Ga0496115_0599169
343 Ga0496116_0000617
344 Ga0501040_0143485
345 Ga0501076_0449654
346 nmdc:mga0k408_56686_c1
347 nmdc:mga05p37_143944_c1
348 nmdc:mga09592_93229_c1
349 nmdc:mga0qj67_349084_c1
350 nmdc:mga08y16_1010049_c1
351 nmdc:mga0n895_227037_c1
352 nmdc:mga0rr50_13792_c1
353 nmdc:mga08x19_432736_c1
354 nmdc:mga08x19_64523_c1
355 nmdc:mga0a205_765359_c1
356 Ga0495601_0645686
357 Ga0495595_0077403
358 Ga0530510_0209859

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08818

DUF1801

Domain of unknown function (DU1801)

48

149

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.7054 8 125
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.6451 8 125
8p1x-assembly1.cif.gz_AAA tarm(se)_g117r-udp-glucose 0.5962 25 104
3imo-assembly2.cif.gz_D structure from the mobile metagenome of vibrio cholerae. integron cassette protein vch_cass14 0.5758 6 127
1zgl-assembly1.cif.gz_A crystal structure of 3a6 tcr bound to mbp/hla-dr2a 0.5711 38 71
ID Description Score Start End Superfamily
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7745 8 125 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7449 8 125 3.90.1150.200
af_Q59V88_283_356_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7372 25 60 1.10.10.10
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6656 8 126 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6354 8 126 3.90.1150.200
ID Description Score Start End GO Terms
AF-A0A7H9VG25-F1-model_v4 DUF1801 domain-containing protein 0.9995 3 126
AF-A0A1H5KFY4-F1-model_v4 YdhG-like domain-containing protein 0.999 1 126
AF-A0A1E4DJ85-F1-model_v4 deleted 0.999 1 126
AF-A0A1Q3J442-F1-model_v4 deleted 0.9987 4 126
AF-A0A7V9TMV2-F1-model_v4 DUF1801 domain-containing protein 0.9986 3 127

Map