F273437

General Info

Members Datasets Scaffolds Average Seq Length
179 124 179 450

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100009419|Ga0070698_1000094198
Length 491
Sequence MPWKDSESLPLHCIPLCELSSRVNLRGQLLQLEQKSLEAFLAAAKKLDAGFATLPDYHSRAPAMQHLAEILDATAERLHDNYPYFHPLYAGQMLKPPHPVARLAYALAMWINPNNHAIDGGRATSTMEKEAVAEIAAMFGWKDFLGHLCGGGTMANLEALWVAGQLQPGKKILASEQSHYTHRRISSVLRLEFESVAADSQGRMDVDALENRVRRGDVGTVVATMGTTATGSVDPLPEILALRDRSGFHVHADAAYGGYFELTQNLADHAKSAFARIAEADSIVIDPHKHGLQPYGCGCVLFRDPGVGTLYKHDSPYTYFSSANLHLGEISLECSRPGAAAAALWATQKLLPLIKGGEFAQGLERCRQAALALHARLSAHDAFVPAFPPELDIVVFAPRASTIPETSSLSRKIFTAAAAHGLHLALAELPVAFFPGLTPKLQIDQKDQKDHHTVTVLRSVLMKPEHLDWVDRIWEIIQSATRQSSRTAATP

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
3 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
4 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
5 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
6 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
32 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
58 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
59 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
60 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
61 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
62 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
65 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
68 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
69 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
70 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
71 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
72 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
73 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
74 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
75 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
76 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
77 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
78 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
79 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
80 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
81 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
82 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
83 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
84 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
85 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
86 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
89 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
90 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
93 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
94 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
95 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
96 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
97 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
98 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
99 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
100 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
101 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
102 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
103 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
104 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
105 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
106 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
107 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
108 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
109 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
110 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
111 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
112 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
113 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
114 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
115 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
116 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
117 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
118 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
119 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
120 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
121 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
122 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
123 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
124 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.88
Metatranscriptomes 1.12
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.91
Rhizosphere 93.3
Stem 0
Stem Tuber 0
Unclassified 2.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10010087 3300005295 Bacteria 2476
2 Ga0070703_10001094 3300005406 Bacteria 8425
3 Ga0070713_100002058 3300005436 Bacteria 12996
4 Ga0070713_100072187 3300005436 Bacteria 2919
5 Ga0070710_10038754 3300005437 Bacteria 2619
6 Ga0070711_100008518 3300005439 Bacteria 6286
7 Ga0070711_100039046 3300005439 Bacteria 3195
8 Ga0070705_100002109 3300005440 Bacteria 10135
9 Ga0070708_100004843 3300005445 Bacteria 10622
10 Ga0070708_100008046 3300005445 Bacteria 8451
11 Ga0070708_100009925 3300005445 Bacteria 7697
12 Ga0070706_100001311 3300005467 Bacteria 26431
13 Ga0070706_100022417 3300005467 Bacteria 5814
14 Ga0070706_100134782 3300005467 Bacteria 2305
15 Ga0070707_100010157 3300005468 Bacteria 8763
16 Ga0070707_100031846 3300005468 Bacteria 5024
17 Ga0070698_100009419 3300005471 Bacteria 10463
18 Ga0070698_100011020 3300005471 Bacteria 9615
19 Ga0070699_100070951 3300005518 Unclassified 3029
20 Ga0070699_100092681 3300005518 Bacteria 2643
21 Ga0070679_100006094 3300005530 Bacteria 11221
22 Ga0070697_100000210 3300005536 Bacteria 47762
23 Ga0070697_100000686 3300005536 Bacteria 25420
24 Ga0070697_100076070 3300005536 Bacteria 2761
25 Ga0070695_100004539 3300005545 Bacteria 8154
26 Ga0070695_100026122 3300005545 Bacteria 3610
27 Ga0070696_100001253 3300005546 Bacteria 16496
28 Ga0070696_100009526 3300005546 Bacteria 6502
29 Ga0070693_100000460 3300005547 Bacteria 18296
30 Ga0070665_100001341 3300005548 Bacteria 29270
31 Ga0070704_100001103 3300005549 Bacteria 14025
32 Ga0068855_100103647 3300005563 Bacteria 3273
33 Ga0068852_100027664 3300005616 Bacteria 4624
34 Ga0068863_100009544 3300005841 Bacteria 9461
35 Ga0068863_100058038 3300005841 Bacteria 3663
36 Ga0068860_100044428 3300005843 Bacteria 4235
37 Ga0068860_100353121 3300005843 Bacteria 1447
38 Ga0070715_10067388 3300006163 Bacteria 1589
39 Ga0070716_100000181 3300006173 Bacteria 24744
40 Ga0070716_100002791 3300006173 Bacteria 8120
41 Ga0070716_100009096 3300006173 Bacteria 4944
42 Ga0070716_100017732 3300006173 Bacteria 3697
43 Ga0070716_100066410 3300006173 Bacteria 2104
44 Ga0070712_100081819 3300006175 Bacteria 2341
45 Ga0068871_100056952 3300006358 Bacteria 3179
46 Ga0075428_100014811 3300006844 Bacteria 8666
47 Ga0075434_100199167 3300006871 Bacteria 2022
48 Ga0075436_100129621 3300006914 Bacteria 1768
49 Ga0075435_100104130 3300007076 Bacteria 2354
50 Ga0075435_100127738 3300007076 Unclassified 2126
51 Ga0075435_100148198 3300007076 Bacteria 1972
52 Ga0099794_10000076 3300007265 Bacteria 36243
53 Ga0099794_10004937 3300007265 Bacteria 5305
54 Ga0099794_10006221 3300007265 Bacteria 4822
55 Ga0099794_10014164 3300007265 Bacteria 3488
56 Ga0099795_10035461 3300007788 Unclassified 1744
57 Ga0105240_10361877 3300009093 Bacteria 1643
58 Ga0105245_10101722 3300009098 Bacteria 2661
59 Ga0105247_10089405 3300009101 Bacteria 1953
60 Ga0105238_10110976 3300009551 Bacteria 2723
61 Ga0157369_10016670 3300013105 Bacteria 8260
62 Ga0157378_10000088 3300013297 Bacteria 86642
63 Ga0157378_10023104 3300013297 Bacteria 5472
64 Ga0157372_10004615 3300013307 Bacteria 14647
65 Ga0157372_10352914 3300013307 Bacteria 1714
66 Ga0182008_10009843 3300014497 Bacteria 5141
67 Ga0157379_10042317 3300014968 Bacteria 4066
68 Ga0157376_10000032 3300014969 Bacteria 167294
69 Ga0207684_10002189 3300025910 Bacteria 19998
70 Ga0207684_10019359 3300025910 Bacteria 5825
71 Ga0207684_10091745 3300025910 Bacteria 2589
72 Ga0207695_10003872 3300025913 Bacteria 20710
73 Ga0207671_10034051 3300025914 Bacteria 3787
74 Ga0207663_10059977 3300025916 Bacteria 2409
75 Ga0207652_10004729 3300025921 Bacteria 11038
76 Ga0207646_10001251 3300025922 Bacteria 31833
77 Ga0207700_10056679 3300025928 Bacteria 2951
78 Ga0207664_10077517 3300025929 Bacteria 2693
79 Ga0207665_10000241 3300025939 Bacteria 37451
80 Ga0207665_10005100 3300025939 Bacteria 8767
81 Ga0207665_10081357 3300025939 Bacteria 2230
82 Ga0207641_10001947 3300026088 Bacteria 19809
83 Ga0207641_10151844 3300026088 Bacteria 2098
84 Ga0209588_1002070 3300027671 Bacteria 5419
85 Ga0209588_1004599 3300027671 Bacteria 3903
86 Ga0209588_1005170 3300027671 Bacteria 3722
87 Ga0209588_1009641 3300027671 Unclassified 2888
88 Ga0209588_1019071 3300027671 Bacteria 2139
89 Ga0265354_1000004 3300028016 Bacteria 35979
90 Ga0265354_1000596 3300028016 Bacteria 6098
91 Ga0268266_10000204 3300028379 Bacteria 104000
92 Ga0268264_10009020 3300028381 Bacteria 8274
93 Ga0265326_10001989 3300028558 Bacteria 6990
94 Ga0265319_1001597 3300028563 Bacteria 13236
95 Ga0265318_10000822 3300028577 Bacteria 20500
96 Ga0265323_10000296 3300028653 Bacteria 28708
97 Ga0265323_10001399 3300028653 Bacteria 11894
98 Ga0265322_10000490 3300028654 Bacteria 15481
99 Ga0265336_10000869 3300028666 Bacteria 15607
100 Ga0265338_10000254 3300028800 Bacteria 97300
101 Ga0265338_10006797 3300028800 Bacteria 14412
102 Ga0265338_10079293 3300028800 Bacteria 2764
103 Ga0265324_10001290 3300029957 Bacteria 14716
104 Ga0265324_10018009 3300029957 Bacteria 2563
105 Ga0265770_1000202 3300030878 Bacteria 7853
106 Ga0265760_10003857 3300031090 Bacteria 4345
107 Ga0265332_10002253 3300031238 Bacteria 9894
108 Ga0265328_10003750 3300031239 Bacteria 6698
109 Ga0265320_10002317 3300031240 Bacteria 13362
110 Ga0265320_10010589 3300031240 Bacteria 5480
111 Ga0265329_10001259 3300031242 Bacteria 12382
112 Ga0265340_10001634 3300031247 Bacteria 12877
113 Ga0265339_10002799 3300031249 Bacteria 12382
114 Ga0265331_10001195 3300031250 Bacteria 19627
115 Ga0265316_10005187 3300031344 Bacteria 12748
116 Ga0265313_10004049 3300031595 Bacteria 11420
117 Ga0265314_10000500 3300031711 Bacteria 50661
118 Ga0265342_10002938 3300031712 Bacteria 14331
119 Ga0265342_10015759 3300031712 Bacteria 4963
120 Ga0307510_10060792 3300033180 Bacteria 3883
121 Ga0316212_1005078 3300033547 Unclassified 1912
122 Ga0373926_0000265 3300035083 Bacteria 12655
123 Ga0373954_0000280 3300035118 Bacteria 18527
124 Ga0373954_0054466 3300035118 Unclassified 1881
125 Ga0373946_0021965 3300035171 Unclassified 2479
126 Ga0373955_0001276 3300035172 Bacteria 10714
127 Ga0373955_0094576 3300035172 Unclassified 1708
128 Ga0373927_0000399 3300035695 Bacteria 33596
129 Ga0373933_0002738 3300035724 Bacteria 9846
130 Ga0373947_0001649 3300035725 Bacteria 13661
131 Ga0373937_0024204 3300036401 Bacteria 5473
132 Ga0373937_0108753 3300036401 Unclassified 2578
133 Ga0373925_0000225 3300037068 Bacteria 60424
134 Ga0400483_021054 3300039062 Bacteria 5544
135 Ga0400489_76338 3300039093 Bacteria 45723
136 Ga0436365_1745258 3300039437 Bacteria 3315
137 Ga0439456_005901 3300042013 Bacteria 2492
138 Ga0495592_0005262 3300046454 Bacteria 9534
139 Ga0495592_0023692 3300046454 Bacteria 4669
140 Ga0495603_0086314 3300046455 Bacteria 1837
141 Ga0495580_0000731 3300046472 Bacteria 28145
142 Ga0495580_0023512 3300046472 Bacteria 4524
143 Ga0495580_0052439 3300046472 Bacteria 2881
144 Ga0495582_0000226 3300046473 Bacteria 31150
145 Ga0495639_0065585 3300046475 Bacteria 1670
146 Ga0495608_0004346 3300046511 Bacteria 10153
147 Ga0495628_0198087 3300046516 Bacteria 1514
148 Ga0495640_0150309 3300046533 Bacteria 1496
149 Ga0495587_0003847 3300046536 Bacteria 9961
150 Ga0495645_0000934 3300046543 Bacteria 19904
151 Ga0495667_0005546 3300046559 Bacteria 8529
152 Ga0495657_0020120 3300046675 Bacteria 4802
153 Ga0495599_0003008 3300046678 Bacteria 9813
154 Ga0495623_0026846 3300046679 Bacteria 3705
155 Ga0495647_0003562 3300046681 Bacteria 4992
156 Ga0495658_0025942 3300046683 Bacteria 3136
157 Ga0495613_0075627 3300046689 Bacteria 2451
158 Ga0495604_0005916 3300047317 Bacteria 9705
159 Ga0495604_0160846 3300047317 Bacteria 1587
160 Ga0495676_0033891 3300047321 Bacteria 4292
161 Ga0495679_002367 3300047446 Bacteria 9663
162 Ga0495602_0010598 3300048088 Bacteria 9563
163 Ga0496100_0028807 3300048903 Bacteria 3429
164 Ga0496102_0191780 3300048905 Bacteria 1926
165 Ga0496114_0004009 3300048917 Bacteria 11380
166 Ga0496114_0128213 3300048917 Bacteria 2189
167 Ga0496114_0253817 3300048917 Bacteria 1548
168 Ga0496115_0012976 3300048918 Bacteria 6286
169 Ga0496115_0112886 3300048918 Unclassified 2233
170 Ga0501042_0062451 3300049578 Bacteria 2662
171 nmdc:mga0n895_23044_c1 3300050512 Bacteria 5847
172 nmdc:mga0n895_6139_c1 3300050512 Bacteria 10149
173 nmdc:mga0rr50_202093_c1 3300050513 Bacteria 1633
174 nmdc:mga08x19_102677_c1 3300050514 Bacteria 1899
175 nmdc:mga08x19_48830_c1 3300050514 Unclassified 2712
176 nmdc:mga08x19_741_c1 3300050514 Bacteria 20847
177 nmdc:mga0a205_8659_c1 3300050515 Bacteria 9262
178 Ga0495601_0000649 3300053077 Bacteria 18532
179 Ga0495595_0026946 3300053084 Bacteria 2557

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048905 Ga0496102_0191780 Ga0496102_0191780_647_1837 394
2 3300036401 Ga0373937_0108753 Ga0373937_0108753_1335_2528 395
3 3300025914 Ga0207671_10034051 Ga0207671_100340512 396
4 3300039093 Ga0400489_76338 Ga0400489_76338_39264_40460 397
5 3300050512 nmdc:mga0n895_23044_c1 nmdc:mga0n895_23044_c1_18_1238 406
6 3300005546 Ga0070696_100001253 Ga0070696_1000012536 414
7 3300005545 Ga0070695_100026122 Ga0070695_1000261222 416
8 3300005471 Ga0070698_100011020 Ga0070698_1000110209 419
9 3300025913 Ga0207695_10003872 Ga0207695_1000387219 422
10 3300046472 Ga0495580_0000731 Ga0495580_0000731_16281_17618 422
11 3300046473 Ga0495582_0000226 Ga0495582_0000226_17590_18927 422
12 3300014497 Ga0182008_10009843 Ga0182008_100098434 428
13 3300009093 Ga0105240_10361877 Ga0105240_103618772 432
14 3300042013 Ga0439456_005901 Ga0439456_005901_384_1691 433
15 3300047446 Ga0495679_002367 Ga0495679_002367_2954_4261 433
16 3300028563 Ga0265319_1001597 Ga0265319_10015972 437
17 3300028577 Ga0265318_10000822 Ga0265318_1000082210 437
18 3300028666 Ga0265336_10000869 Ga0265336_100008699 437
19 3300028800 Ga0265338_10000254 Ga0265338_1000025417 437
20 3300029957 Ga0265324_10018009 Ga0265324_100180092 437
21 3300031240 Ga0265320_10010589 Ga0265320_100105891 437
22 3300031247 Ga0265340_10001634 Ga0265340_100016345 437
23 3300031595 Ga0265313_10004049 Ga0265313_100040494 437
24 3300048918 Ga0496115_0112886 Ga0496115_0112886_443_1801 442
25 3300005436 Ga0070713_100072187 Ga0070713_1000721872 443
26 3300005437 Ga0070710_10038754 Ga0070710_100387541 443
27 3300005439 Ga0070711_100008518 Ga0070711_1000085183 443
28 3300007265 Ga0099794_10000076 Ga0099794_1000007629 443
29 3300025928 Ga0207700_10056679 Ga0207700_100566792 443
30 3300027671 Ga0209588_1005170 Ga0209588_10051703 443
31 3300028653 Ga0265323_10001399 Ga0265323_100013995 444
32 3300033180 Ga0307510_10060792 Ga0307510_100607922 444
33 3300049578 Ga0501042_0062451 Ga0501042_0062451_384_1724 444
34 3300005841 Ga0068863_100058038 Ga0068863_1000580382 445
35 3300005843 Ga0068860_100353121 Ga0068860_1003531212 445
36 3300006358 Ga0068871_100056952 Ga0068871_1000569522 445
37 3300014969 Ga0157376_10000032 Ga0157376_1000003225 445
38 3300025916 Ga0207663_10059977 Ga0207663_100599772 445
39 3300026088 Ga0207641_10151844 Ga0207641_101518442 445
40 3300028558 Ga0265326_10001989 Ga0265326_100019895 445
41 3300028653 Ga0265323_10000296 Ga0265323_1000029611 445
42 3300028654 Ga0265322_10000490 Ga0265322_100004905 445
43 3300028800 Ga0265338_10006797 Ga0265338_100067979 445
44 3300029957 Ga0265324_10001290 Ga0265324_1000129010 445
45 3300031238 Ga0265332_10002253 Ga0265332_100022535 445
46 3300031239 Ga0265328_10003750 Ga0265328_100037502 445
47 3300031240 Ga0265320_10002317 Ga0265320_1000231712 445
48 3300031242 Ga0265329_10001259 Ga0265329_100012599 445
49 3300031249 Ga0265339_10002799 Ga0265339_100027999 445
50 3300031250 Ga0265331_10001195 Ga0265331_100011958 445
51 3300031344 Ga0265316_10005187 Ga0265316_1000518710 445
52 3300031711 Ga0265314_10000500 Ga0265314_100005009 445
53 3300031712 Ga0265342_10002938 Ga0265342_100029382 445
54 3300046454 Ga0495592_0005262 Ga0495592_0005262_701_2050 445
55 3300046472 Ga0495580_0023512 Ga0495580_0023512_2990_4345 445
56 3300048917 Ga0496114_0004009 Ga0496114_0004009_291_1628 445
57 3300005436 Ga0070713_100002058 Ga0070713_10000205811 446
58 3300005467 Ga0070706_100134782 Ga0070706_1001347822 446
59 3300005468 Ga0070707_100010157 Ga0070707_1000101572 446
60 3300005468 Ga0070707_100031846 Ga0070707_1000318462 446
61 3300005536 Ga0070697_100000686 Ga0070697_10000068611 446
62 3300005536 Ga0070697_100076070 Ga0070697_1000760702 446
63 3300006163 Ga0070715_10067388 Ga0070715_100673881 446
64 3300006173 Ga0070716_100017732 Ga0070716_1000177323 446
65 3300006173 Ga0070716_100066410 Ga0070716_1000664102 446
66 3300006871 Ga0075434_100199167 Ga0075434_1001991672 446
67 3300007076 Ga0075435_100104130 Ga0075435_1001041302 446
68 3300025910 Ga0207684_10091745 Ga0207684_100917452 446
69 3300025922 Ga0207646_10001251 Ga0207646_1000125117 446
70 3300025939 Ga0207665_10005100 Ga0207665_100051004 446
71 3300025939 Ga0207665_10081357 Ga0207665_100813572 446
72 3300039062 Ga0400483_021054 Ga0400483_021054_323_1672 446
73 3300046475 Ga0495639_0065585 Ga0495639_0065585_165_1505 446
74 3300046533 Ga0495640_0150309 Ga0495640_0150309_51_1391 446
75 3300046681 Ga0495647_0003562 Ga0495647_0003562_344_1684 446
76 3300046683 Ga0495658_0025942 Ga0495658_0025942_1646_2986 446
77 3300046689 Ga0495613_0075627 Ga0495613_0075627_535_1875 446
78 3300047321 Ga0495676_0033891 Ga0495676_0033891_1589_2929 446
79 3300048903 Ga0496100_0028807 Ga0496100_0028807_876_2216 446
80 3300048917 Ga0496114_0128213 Ga0496114_0128213_241_1581 446
81 3300048917 Ga0496114_0253817 Ga0496114_0253817_29_1411 446
82 3300048918 Ga0496115_0012976 Ga0496115_0012976_4486_5826 446
83 3300005548 Ga0070665_100001341 Ga0070665_1000013417 447
84 3300006173 Ga0070716_100009096 Ga0070716_1000090962 447
85 3300009101 Ga0105247_10089405 Ga0105247_100894052 447
86 3300028379 Ga0268266_10000204 Ga0268266_100002048 447
87 3300005439 Ga0070711_100039046 Ga0070711_1000390464 448
88 3300005841 Ga0068863_100009544 Ga0068863_1000095448 448
89 3300005843 Ga0068860_100044428 Ga0068860_1000444282 448
90 3300006173 Ga0070716_100002791 Ga0070716_1000027913 448
91 3300006175 Ga0070712_100081819 Ga0070712_1000818192 448
92 3300007076 Ga0075435_100127738 Ga0075435_1001277382 448
93 3300009098 Ga0105245_10101722 Ga0105245_101017223 448
94 3300013297 Ga0157378_10000088 Ga0157378_1000008868 448
95 3300014968 Ga0157379_10042317 Ga0157379_100423173 448
96 3300026088 Ga0207641_10001947 Ga0207641_1000194715 448
97 3300028381 Ga0268264_10009020 Ga0268264_100090202 448
98 3300028800 Ga0265338_10079293 Ga0265338_100792932 448
99 3300031712 Ga0265342_10015759 Ga0265342_100157594 448
100 3300035118 Ga0373954_0000280 Ga0373954_0000280_15294_16646 448
101 3300035172 Ga0373955_0001276 Ga0373955_0001276_1993_3345 448
102 3300035724 Ga0373933_0002738 Ga0373933_0002738_16_1368 448
103 3300036401 Ga0373937_0024204 Ga0373937_0024204_1993_3345 448
104 3300046454 Ga0495592_0023692 Ga0495592_0023692_42_1394 448
105 3300046455 Ga0495603_0086314 Ga0495603_0086314_357_1703 448
106 3300046511 Ga0495608_0004346 Ga0495608_0004346_7431_8783 448
107 3300046516 Ga0495628_0198087 Ga0495628_0198087_53_1405 448
108 3300046536 Ga0495587_0003847 Ga0495587_0003847_3479_4831 448
109 3300046543 Ga0495645_0000934 Ga0495645_0000934_3277_4629 448
110 3300046559 Ga0495667_0005546 Ga0495667_0005546_6582_7934 448
111 3300046675 Ga0495657_0020120 Ga0495657_0020120_541_1893 448
112 3300046678 Ga0495599_0003008 Ga0495599_0003008_2813_4165 448
113 3300046679 Ga0495623_0026846 Ga0495623_0026846_2165_3517 448
114 3300047317 Ga0495604_0005916 Ga0495604_0005916_1613_2965 448
115 3300048088 Ga0495602_0010598 Ga0495602_0010598_5344_6696 448
116 3300050512 nmdc:mga0n895_6139_c1 nmdc:mga0n895_6139_c1_5082_6428 448
117 3300053077 Ga0495601_0000649 Ga0495601_0000649_4783_6135 448
118 3300053084 Ga0495595_0026946 Ga0495595_0026946_975_2327 448
119 3300005445 Ga0070708_100009925 Ga0070708_10000992510 449
120 3300005467 Ga0070706_100022417 Ga0070706_1000224177 449
121 3300025910 Ga0207684_10019359 Ga0207684_100193593 449
122 3300047317 Ga0495604_0160846 Ga0495604_0160846_200_1555 449
123 3300050515 nmdc:mga0a205_8659_c1 nmdc:mga0a205_8659_c1_6468_7856 449
124 3300028016 Ga0265354_1000004 Ga0265354_100000420 450
125 3300030878 Ga0265770_1000202 Ga0265770_10002024 450
126 3300005445 Ga0070708_100008046 Ga0070708_1000080467 451
127 3300006844 Ga0075428_100014811 Ga0075428_1000148112 451
128 3300007265 Ga0099794_10006221 Ga0099794_100062214 451
129 3300007265 Ga0099794_10014164 Ga0099794_100141643 451
130 3300027671 Ga0209588_1002070 Ga0209588_10020702 451
131 3300027671 Ga0209588_1004599 Ga0209588_10045992 451
132 3300035118 Ga0373954_0054466 Ga0373954_0054466_439_1800 451
133 3300035172 Ga0373955_0094576 Ga0373955_0094576_43_1404 451
134 3300046472 Ga0495580_0052439 Ga0495580_0052439_884_2248 451
135 3300005471 Ga0070698_100009419 Ga0070698_1000094198 452
136 3300013307 Ga0157372_10352914 Ga0157372_103529141 452
137 3300039437 Ga0436365_1745258 Ga0436365_1745258_1799_3178 453
138 3300005518 Ga0070699_100092681 Ga0070699_1000926812 454
139 3300005546 Ga0070696_100009526 Ga0070696_1000095262 454
140 3300005563 Ga0068855_100103647 Ga0068855_1001036473 455
141 3300005616 Ga0068852_100027664 Ga0068852_1000276644 455
142 3300009551 Ga0105238_10110976 Ga0105238_101109762 455
143 3300013105 Ga0157369_10016670 Ga0157369_100166702 455
144 3300013307 Ga0157372_10004615 Ga0157372_100046155 455
145 3300025929 Ga0207664_10077517 Ga0207664_100775172 455
146 3300050514 nmdc:mga08x19_48830_c1 nmdc:mga08x19_48830_c1_1271_2644 455
147 3300005406 Ga0070703_10001094 Ga0070703_100010943 457
148 3300005440 Ga0070705_100002109 Ga0070705_1000021098 457
149 3300005445 Ga0070708_100004843 Ga0070708_1000048437 457
150 3300005467 Ga0070706_100001311 Ga0070706_1000013116 457
151 3300005518 Ga0070699_100070951 Ga0070699_1000709512 457
152 3300005530 Ga0070679_100006094 Ga0070679_1000060949 457
153 3300005536 Ga0070697_100000210 Ga0070697_10000021033 457
154 3300005545 Ga0070695_100004539 Ga0070695_1000045395 457
155 3300005547 Ga0070693_100000460 Ga0070693_1000004607 457
156 3300005549 Ga0070704_100001103 Ga0070704_10000110310 457
157 3300006173 Ga0070716_100000181 Ga0070716_10000018116 457
158 3300006914 Ga0075436_100129621 Ga0075436_1001296211 457
159 3300007076 Ga0075435_100148198 Ga0075435_1001481981 457
160 3300025910 Ga0207684_10002189 Ga0207684_1000218914 457
161 3300025921 Ga0207652_10004729 Ga0207652_100047293 457
162 3300025939 Ga0207665_10000241 Ga0207665_1000024115 457
163 3300027671 Ga0209588_1019071 Ga0209588_10190712 457
164 3300028016 Ga0265354_1000596 Ga0265354_10005966 457
165 3300031090 Ga0265760_10003857 Ga0265760_100038573 457
166 3300033547 Ga0316212_1005078 Ga0316212_10050782 457
167 3300035083 Ga0373926_0000265 Ga0373926_0000265_6235_7614 457
168 3300035171 Ga0373946_0021965 Ga0373946_0021965_99_1478 457
169 3300035695 Ga0373927_0000399 Ga0373927_0000399_15143_16522 457
170 3300035725 Ga0373947_0001649 Ga0373947_0001649_3782_5161 457
171 3300037068 Ga0373925_0000225 Ga0373925_0000225_32266_33645 457
172 3300050513 nmdc:mga0rr50_202093_c1 nmdc:mga0rr50_202093_c1_204_1583 457
173 3300050514 nmdc:mga08x19_102677_c1 nmdc:mga08x19_102677_c1_24_1418 457
174 3300050514 nmdc:mga08x19_741_c1 nmdc:mga08x19_741_c1_1195_2574 457
175 3300007265 Ga0099794_10004937 Ga0099794_100049373 458
176 3300007788 Ga0099795_10035461 Ga0099795_100354612 458
177 3300027671 Ga0209588_1009641 Ga0209588_10096411 458
178 3300005295 Ga0065707_10010087 Ga0065707_100100872 459
179 3300013297 Ga0157378_10023104 Ga0157378_100231044 459

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

123

285

0.89

PF00282

Pyridoxal_deC

Pyridoxal-dependent decarboxylase conserved domain

160

399

0.85

PF01212

Beta_elim_lyase

Beta-eliminating lyase

116

456

0.85

PF00266

Aminotran_5

Aminotransferase class-V

100

310

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cwz-assembly2.cif.gz_B crystal structure of a tyrosine decarboxylase from enterococcus faecalis k392a mutant in complex with the cofactor plp and l-dopa 0.8594 5 443
7cwx-assembly2.cif.gz_B crystal structure of a tyrosine decarboxylase from enterococcus faecalis 0.8517 5 446
7cwy-assembly1.cif.gz_A crystal structure of a tyrosine decarboxylase from enterococcus faecalis in complex with the cofactor plp 0.8507 5 446
7cwx-assembly1.cif.gz_A-2 crystal structure of a tyrosine decarboxylase from enterococcus faecalis 0.8486 5 449
6ebn-assembly1.cif.gz_B crystal structure of psilocybe cubensis noncanonical aromatic amino acid decarboxylase 0.8484 5 446
ID Description Score Start End Superfamily
af_Q52RG7_406_499_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.8876 330 444 3.90.1150.10
af_A0A0R0I4X1_15_270_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8625 95 284 3.40.640.10
af_Q52RG7_406_499_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.8621 330 444 3.90.1150.10
af_Q55CE1_140_522_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8612 88 292 3.40.640.10
af_Q9V7Y2_400_493_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.8569 330 438 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A841K6V9-F1-model_v4 Glutamate/tyrosine decarboxylase-like PLP-dependent enzyme 0.9673 39 443 GO:0016831
GO:0019752
GO:0030170
AF-A0A7C5DRX9-F1-model_v4 Aspartate aminotransferase family protein 0.9662 1 283 GO:0008483
GO:0016831
GO:0019752
GO:0030170
AF-A0A7C5DRX9-F1-model_v4 Aspartate aminotransferase family protein 0.9628 1 283 GO:0008483
GO:0016831
GO:0019752
GO:0030170
AF-A0A841K6V9-F1-model_v4 Glutamate/tyrosine decarboxylase-like PLP-dependent enzyme 0.9512 39 443 GO:0016831
GO:0019752
GO:0030170
AF-T0ZTK9-F1-model_v4 Pyridoxal-dependent decarboxylase family protein 0.9478 109 308 GO:0016831
GO:0019752
GO:0030170

Feature Viewer

pLDDT pTM Quality
86.39 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map