F273277

General Info

Members Datasets Scaffolds Average Seq Length
179 111 358 175

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100071374|Ga0070689_1000713744
Length 196
Sequence MIRTRMINANSDSPGLTWLAFAFLTVVSWGVYGVFLHTGQVAMQDPVNGRYKAFLFVGIAYFLTAVLAPLALLLVKGAAFSGYTARGMGWSLFAGIVGAIXXXXVLLAFGAKGTPAVVMSIVFAGAPVVNALYALLLHPPAGGWGSVRPQFYLGIVLAALGGCLVTFYKPNPPAPKAKTVAVEITPAAPSTSPAQH

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
65 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
67 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
68 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
69 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
70 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
71 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
72 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
73 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
74 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
75 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
76 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
77 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
78 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
79 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
82 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
83 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
84 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
88 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
89 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
90 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
91 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
92 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
93 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
94 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
95 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
96 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
97 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
98 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
99 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
100 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
101 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
102 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
105 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
106 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
107 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
108 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
109 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
110 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
111 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.12
Rhizosphere 97.77
Stem 0
Stem Tuber 0
Unclassified 40.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100071374 3300005340 Unclassified 2713
2 Ga0065707_10119029 3300005295 Bacteria 2170
3 Ga0070690_100053536 3300005330 Unclassified 2582
4 Ga0070670_100542185 3300005331 Bacteria 1037
5 Ga0070689_100057861 3300005340 Bacteria 3010
6 Ga0070689_100144593 3300005340 Unclassified 1914
7 Ga0070689_100411747 3300005340 Unclassified 1144
8 Ga0070689_100871769 3300005340 Unclassified 795
9 Ga0070668_100279367 3300005347 Unclassified 1394
10 Ga0070668_100432228 3300005347 Bacteria 1129
11 Ga0070673_100267836 3300005364 Bacteria 1494
12 Ga0070688_100035516 3300005365 Unclassified 3028
13 Ga0070709_10000015 3300005434 Bacteria 145128
14 Ga0070713_100020094 3300005436 Bacteria 5113
15 Ga0070713_100214229 3300005436 Bacteria 1745
16 Ga0070694_100302366 3300005444 Bacteria 1226
17 Ga0070708_100641825 3300005445 Unclassified 1001
18 Ga0070681_10287256 3300005458 Bacteria 1555
19 Ga0068867_100374220 3300005459 Unclassified 1195
20 Ga0070685_11070238 3300005466 Unclassified 608
21 Ga0070706_100115820 3300005467 Bacteria 2496
22 Ga0070707_100379085 3300005468 Unclassified 1374
23 Ga0070698_100161044 3300005471 Bacteria 2188
24 Ga0070684_101172810 3300005535 Unclassified 722
25 Ga0070686_100234274 3300005544 Unclassified 1333
26 Ga0070696_100080308 3300005546 Bacteria 2308
27 Ga0070696_101082141 3300005546 Bacteria 673
28 Ga0070665_100076743 3300005548 Bacteria 3348
29 Ga0068857_100010645 3300005577 Bacteria 7999
30 Ga0068857_100131520 3300005577 Unclassified 2257
31 Ga0068859_100210987 3300005617 Bacteria 2028
32 Ga0068859_100550282 3300005617 Unclassified 1248
33 Ga0068859_100870916 3300005617 Bacteria 986
34 Ga0068859_100940179 3300005617 Unclassified 948
35 Ga0068864_100433642 3300005618 Bacteria 1254
36 Ga0068864_100525613 3300005618 Unclassified 1141
37 Ga0068864_100626217 3300005618 Bacteria 1046
38 Ga0068870_10353652 3300005840 Unclassified 943
39 Ga0068863_100343061 3300005841 Unclassified 1453
40 Ga0068858_100925910 3300005842 Unclassified 853
41 Ga0068860_100685586 3300005843 Unclassified 1034
42 Ga0068862_100009083 3300005844 Bacteria 8226
43 Ga0075428_100004720 3300006844 Bacteria 15083
44 Ga0075428_100407838 3300006844 Unclassified 1456
45 Ga0075428_101216102 3300006844 Bacteria 794
46 Ga0075428_101273217 3300006844 Bacteria 774
47 Ga0075430_100146473 3300006846 Bacteria 1967
48 Ga0075431_100094885 3300006847 Bacteria 3079
49 Ga0075433_10361716 3300006852 Bacteria 1282
50 Ga0075433_10539855 3300006852 Bacteria 1025
51 Ga0075433_11228291 3300006852 Bacteria 650
52 Ga0075434_100023999 3300006871 Bacteria 5955
53 Ga0075434_100246952 3300006871 Unclassified 1804
54 Ga0075429_100021809 3300006880 Bacteria 5553
55 Ga0075429_100087510 3300006880 Bacteria 2715
56 Ga0075429_100341829 3300006880 Bacteria 1310
57 Ga0075436_100357468 3300006914 Bacteria 1053
58 Ga0097620_100210995 3300006931 Bacteria 2028
59 Ga0097620_100550319 3300006931 Unclassified 1248
60 Ga0097620_100870897 3300006931 Bacteria 986
61 Ga0097620_100940135 3300006931 Unclassified 948
62 Ga0099794_10567656 3300007265 Unclassified 600
63 Ga0111539_10041538 3300009094 Bacteria 5529
64 Ga0111539_10097761 3300009094 Bacteria 3449
65 Ga0111539_10150709 3300009094 Unclassified 2722
66 Ga0111539_10158388 3300009094 Unclassified 2649
67 Ga0111539_10210330 3300009094 Bacteria 2267
68 Ga0111539_10260520 3300009094 Unclassified 2019
69 Ga0111539_10374467 3300009094 Bacteria 1657
70 Ga0111539_10533712 3300009094 Bacteria 1367
71 Ga0111539_11242220 3300009094 Bacteria 865
72 Ga0114129_10569314 3300009147 Unclassified 1471
73 Ga0105242_10215156 3300009176 Bacteria 1714
74 Ga0105248_10529794 3300009177 Bacteria 1329
75 Ga0105249_11351229 3300009553 Unclassified 784
76 Ga0105239_11416148 3300010375 Unclassified 802
77 Ga0157371_10175049 3300013102 Bacteria 1534
78 Ga0157374_10601094 3300013296 Unclassified 1110
79 Ga0157374_10673658 3300013296 Bacteria 1047
80 Ga0163162_10240596 3300013306 Unclassified 1941
81 Ga0163162_10664032 3300013306 Unclassified 1166
82 Ga0157375_10000221 3300013308 Bacteria 53553
83 Ga0163163_10032997 3300014325 Bacteria 5004
84 Ga0163163_10882831 3300014325 Unclassified 957
85 Ga0157380_10506492 3300014326 Bacteria 1174
86 Ga0157377_10274477 3300014745 Unclassified 1102
87 Ga0157376_10142617 3300014969 Bacteria 2151
88 Ga0157376_10234399 3300014969 Unclassified 1706
89 Ga0157376_10303447 3300014969 Unclassified 1512
90 Ga0157376_10414051 3300014969 Unclassified 1306
91 Ga0207680_10065717 3300025903 Bacteria 2228
92 Ga0207680_10113623 3300025903 Bacteria 1761
93 Ga0207699_10000011 3300025906 Bacteria 282783
94 Ga0207686_10315617 3300025934 Unclassified 1166
95 Ga0207670_10008705 3300025936 Bacteria 5745
96 Ga0207670_10040476 3300025936 Unclassified 3059
97 Ga0207670_10043942 3300025936 Bacteria 2954
98 Ga0207670_10213560 3300025936 Unclassified 1473
99 Ga0207665_10023503 3300025939 Bacteria 4060
100 Ga0207711_10441727 3300025941 Bacteria 1211
101 Ga0207712_10216137 3300025961 Unclassified 1530
102 Ga0207668_11005669 3300025972 Unclassified 745
103 Ga0207708_10887024 3300026075 Unclassified 771
104 Ga0207641_10214497 3300026088 Bacteria 1782
105 Ga0207641_10289574 3300026088 Bacteria 1543
106 Ga0207641_10399309 3300026088 Bacteria 1320
107 Ga0207674_10005310 3300026116 Bacteria 15326
108 Ga0207674_10082913 3300026116 Bacteria 3206
109 Ga0207428_10215439 3300027907 Bacteria 1441
110 Ga0207428_10326900 3300027907 Bacteria 1131
111 Ga0268265_10006051 3300028380 Bacteria 8222
112 Ga0265326_10061047 3300028558 Bacteria 1066
113 Ga0265319_1138233 3300028563 Bacteria 756
114 Ga0265338_10004857 3300028800 Bacteria 17919
115 Ga0265338_10125680 3300028800 Unclassified 2035
116 Ga0265324_10012071 3300029957 Unclassified 3271
117 Ga0265324_10026610 3300029957 Unclassified 2047
118 Ga0265332_10020868 3300031238 Bacteria 2893
119 Ga0265328_10015522 3300031239 Bacteria 2982
120 Ga0265320_10024477 3300031240 Unclassified 3193
121 Ga0265329_10003363 3300031242 Bacteria 6988
122 Ga0265340_10191485 3300031247 Bacteria 922
123 Ga0265339_10014953 3300031249 Unclassified 4665
124 Ga0265316_10211967 3300031344 Bacteria 1432
125 Ga0265314_10304798 3300031711 Bacteria 892
126 Ga0307410_10623419 3300031852 Bacteria 902
127 Ga0307412_10044234 3300031911 Unclassified 2905
128 Ga0307409_100126270 3300031995 Bacteria 2177
129 Ga0307411_10065342 3300032005 Unclassified 2440
130 Ga0373929_0000015 3300035085 Bacteria 146315
131 Ga0373935_0148919 3300035692 Bacteria 1587
132 Ga0373927_0248215 3300035695 Bacteria 1170
133 Ga0373937_1449017 3300036401 Unclassified 634
134 Ga0373925_0214092 3300037068 Bacteria 1536
135 Ga0451807_0512675 3300041486 Unclassified 752
136 Ga0451807_0737269 3300041486 Bacteria 694
137 Ga0451837_1374548 3300041494 Bacteria 1769
138 Ga0451577_0006306 3300042876 Bacteria 11871
139 Ga0451577_0301522 3300042876 Bacteria 1452
140 Ga0453683_0078347 3300044673 Bacteria 2070
141 Ga0453684_0056924 3300044712 Bacteria 5067
142 Ga0453684_0105876 3300044712 Bacteria 3429
143 Ga0451576_0073833 3300045051 Bacteria 3550
144 Ga0451576_0076259 3300045051 Bacteria 3489
145 Ga0451576_0181946 3300045051 Unclassified 2195
146 Ga0451576_0208090 3300045051 Bacteria 2043
147 Ga0451576_0655587 3300045051 Unclassified 1103
148 Ga0451576_0672130 3300045051 Unclassified 1088
149 Ga0495618_0105980 3300046514 Unclassified 1800
150 Ga0495643_0000169 3300046522 Bacteria 103635
151 Ga0495586_0254142 3300046535 Unclassified 1003
152 Ga0495645_0048214 3300046543 Unclassified 3103
153 Ga0495667_0074706 3300046559 Bacteria 2207
154 Ga0495657_0154082 3300046675 Unclassified 1425
155 Ga0495636_0390704 3300047318 Unclassified 661
156 Ga0495674_0547998 3300047319 Unclassified 921
157 Ga0495684_0096824 3300047471 Bacteria 2233
158 Ga0496121_0108541 3300048924 Unclassified 2123
159 Ga0501034_0492473 3300049571 Unclassified 1140
160 Ga0501034_0563863 3300049571 Bacteria 1047
161 Ga0501081_0198723 3300049743 Bacteria 1454
162 nmdc:mga05p37_370535_c1 3300050507 Unclassified 1681
163 nmdc:mga09592_23410_c1 3300050508 Bacteria 5101
164 nmdc:mga09592_548075_c1 3300050508 Bacteria 993
165 nmdc:mga09592_711253_c1 3300050508 Unclassified 854
166 nmdc:mga06r32_28647_c1 3300050510 Bacteria 5214
167 nmdc:mga06r32_482368_c1 3300050510 Bacteria 1218
168 nmdc:mga08y16_1016726_c1 3300050511 Bacteria 808
169 nmdc:mga08y16_125518_c1 3300050511 Unclassified 2670
170 nmdc:mga08y16_15048_c1 3300050511 Bacteria 8135
171 nmdc:mga08y16_207055_c1 3300050511 Bacteria 2032
172 nmdc:mga08y16_280498_c1 3300050511 Unclassified 1719
173 nmdc:mga08y16_519740_c1 3300050511 Unclassified 1207
174 nmdc:mga08y16_535689_c1 3300050511 Bacteria 1186
175 nmdc:mga0n895_276775_c1 3300050512 Unclassified 1702
176 nmdc:mga0n895_52585_c1 3300050512 Bacteria 3999
177 nmdc:mga08x19_554961_c1 3300050514 Bacteria 813
178 nmdc:mga0a205_160580_c1 3300050515 Bacteria 2144
179 nmdc:mga0a205_509998_c1 3300050515 Bacteria 1059
180 Ga0070689_100071374
181 Ga0065707_10119029
182 Ga0070690_100053536
183 Ga0070670_100542185
184 Ga0070689_100057861
185 Ga0070689_100144593
186 Ga0070689_100411747
187 Ga0070689_100871769
188 Ga0070668_100279367
189 Ga0070668_100432228
190 Ga0070673_100267836
191 Ga0070688_100035516
192 Ga0070709_10000015
193 Ga0070713_100020094
194 Ga0070713_100214229
195 Ga0070694_100302366
196 Ga0070708_100641825
197 Ga0070681_10287256
198 Ga0068867_100374220
199 Ga0070685_11070238
200 Ga0070706_100115820
201 Ga0070707_100379085
202 Ga0070698_100161044
203 Ga0070684_101172810
204 Ga0070686_100234274
205 Ga0070696_100080308
206 Ga0070696_101082141
207 Ga0070665_100076743
208 Ga0068857_100010645
209 Ga0068857_100131520
210 Ga0068859_100210987
211 Ga0068859_100550282
212 Ga0068859_100870916
213 Ga0068859_100940179
214 Ga0068864_100433642
215 Ga0068864_100525613
216 Ga0068864_100626217
217 Ga0068870_10353652
218 Ga0068863_100343061
219 Ga0068858_100925910
220 Ga0068860_100685586
221 Ga0068862_100009083
222 Ga0075428_100004720
223 Ga0075428_100407838
224 Ga0075428_101216102
225 Ga0075428_101273217
226 Ga0075430_100146473
227 Ga0075431_100094885
228 Ga0075433_10361716
229 Ga0075433_10539855
230 Ga0075433_11228291
231 Ga0075434_100023999
232 Ga0075434_100246952
233 Ga0075429_100021809
234 Ga0075429_100087510
235 Ga0075429_100341829
236 Ga0075436_100357468
237 Ga0097620_100210995
238 Ga0097620_100550319
239 Ga0097620_100870897
240 Ga0097620_100940135
241 Ga0099794_10567656
242 Ga0111539_10041538
243 Ga0111539_10097761
244 Ga0111539_10150709
245 Ga0111539_10158388
246 Ga0111539_10210330
247 Ga0111539_10260520
248 Ga0111539_10374467
249 Ga0111539_10533712
250 Ga0111539_11242220
251 Ga0114129_10569314
252 Ga0105242_10215156
253 Ga0105248_10529794
254 Ga0105249_11351229
255 Ga0105239_11416148
256 Ga0157371_10175049
257 Ga0157374_10601094
258 Ga0157374_10673658
259 Ga0163162_10240596
260 Ga0163162_10664032
261 Ga0157375_10000221
262 Ga0163163_10032997
263 Ga0163163_10882831
264 Ga0157380_10506492
265 Ga0157377_10274477
266 Ga0157376_10142617
267 Ga0157376_10234399
268 Ga0157376_10303447
269 Ga0157376_10414051
270 Ga0207680_10065717
271 Ga0207680_10113623
272 Ga0207699_10000011
273 Ga0207686_10315617
274 Ga0207670_10008705
275 Ga0207670_10040476
276 Ga0207670_10043942
277 Ga0207670_10213560
278 Ga0207665_10023503
279 Ga0207711_10441727
280 Ga0207712_10216137
281 Ga0207668_11005669
282 Ga0207708_10887024
283 Ga0207641_10214497
284 Ga0207641_10289574
285 Ga0207641_10399309
286 Ga0207674_10005310
287 Ga0207674_10082913
288 Ga0207428_10215439
289 Ga0207428_10326900
290 Ga0268265_10006051
291 Ga0265326_10061047
292 Ga0265319_1138233
293 Ga0265338_10004857
294 Ga0265338_10125680
295 Ga0265324_10012071
296 Ga0265324_10026610
297 Ga0265332_10020868
298 Ga0265328_10015522
299 Ga0265320_10024477
300 Ga0265329_10003363
301 Ga0265340_10191485
302 Ga0265339_10014953
303 Ga0265316_10211967
304 Ga0265314_10304798
305 Ga0307410_10623419
306 Ga0307412_10044234
307 Ga0307409_100126270
308 Ga0307411_10065342
309 Ga0373929_0000015
310 Ga0373935_0148919
311 Ga0373927_0248215
312 Ga0373937_1449017
313 Ga0373925_0214092
314 Ga0451807_0512675
315 Ga0451807_0737269
316 Ga0451837_1374548
317 Ga0451577_0006306
318 Ga0451577_0301522
319 Ga0453683_0078347
320 Ga0453684_0056924
321 Ga0453684_0105876
322 Ga0451576_0073833
323 Ga0451576_0076259
324 Ga0451576_0181946
325 Ga0451576_0208090
326 Ga0451576_0655587
327 Ga0451576_0672130
328 Ga0495618_0105980
329 Ga0495643_0000169
330 Ga0495586_0254142
331 Ga0495645_0048214
332 Ga0495667_0074706
333 Ga0495657_0154082
334 Ga0495636_0390704
335 Ga0495674_0547998
336 Ga0495684_0096824
337 Ga0496121_0108541
338 Ga0501034_0492473
339 Ga0501034_0563863
340 Ga0501081_0198723
341 nmdc:mga05p37_370535_c1
342 nmdc:mga09592_23410_c1
343 nmdc:mga09592_548075_c1
344 nmdc:mga09592_711253_c1
345 nmdc:mga06r32_28647_c1
346 nmdc:mga06r32_482368_c1
347 nmdc:mga08y16_1016726_c1
348 nmdc:mga08y16_125518_c1
349 nmdc:mga08y16_15048_c1
350 nmdc:mga08y16_207055_c1
351 nmdc:mga08y16_280498_c1
352 nmdc:mga08y16_519740_c1
353 nmdc:mga08y16_535689_c1
354 nmdc:mga0n895_276775_c1
355 nmdc:mga0n895_52585_c1
356 nmdc:mga08x19_554961_c1
357 nmdc:mga0a205_160580_c1
358 nmdc:mga0a205_509998_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map