F272846

General Info

Members Datasets Scaffolds Average Seq Length
178 137 170 252

Family's Representative Sequence

Representative Sequence 3300053119|Ga0500595_007401|Ga0500595_007401_1706_2536
Length 276
Sequence MNIRKHAQIRFPGYLYLDCHRLSPYNRSIMAAQAQTVDPEEIERFSRIAEEWWDENGKFRPLHRLGPVRLKYIRDNAMRHFGRDADEMQALSGLQVLDIGCGGGLLCEPVTRMGAKVTGIDASEKNIRVASLHAEKMGLEIDYRCASPEELNTGTAYDIVLALEIVEHVADVPLFLKSCVSLVRPGGMLFMSTLNRTVKSYGLAIVGAEYVLRWLPRGTHQWKKFLKPSELCGGLRREGMTIENMSGMAFNPFRNEWHLSDTDLDVNYLLAAIRPA

Samples

Sample ID Description Type Environment
1 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
2 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
3 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
4 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
5 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
6 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
7 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
8 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
42 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
43 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
81 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
82 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
83 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
84 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
85 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
86 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
87 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
88 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
89 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
90 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
98 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
99 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
104 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
105 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
106 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
107 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
123 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
124 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
125 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
126 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
127 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
128 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
129 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
130 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
131 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
132 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
133 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
134 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
135 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
136 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
137 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.51
Metatranscriptomes 0
Isolates 4.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.1
Nodule 2.25
Rhizoplane 0.56
Rhizosphere 72.47
Stem 0
Stem Tuber 0
Unclassified 5.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10221818 3300003323 Bacteria 1094
2 rootH1_10343455 3300003323 Bacteria 1837
3 Ga0070658_10001553 3300005327 Bacteria 19460
4 Ga0070658_10287138 3300005327 Bacteria 1401
5 Ga0070658_10611188 3300005327 Bacteria 945
6 Ga0070683_100002532 3300005329 Bacteria 14580
7 Ga0070680_100003649 3300005336 Bacteria 11497
8 Ga0070660_100460430 3300005339 Bacteria 1056
9 Ga0070691_10003566 3300005341 Bacteria 7020
10 Ga0070661_100047689 3300005344 Bacteria 3135
11 Ga0070675_100058701 3300005354 Bacteria 3173
12 Ga0070659_100175451 3300005366 Bacteria 1757
13 Ga0070714_100658959 3300005435 Bacteria 1008
14 Ga0070678_100096182 3300005456 Bacteria 2284
15 Ga0070681_10004870 3300005458 Bacteria 12881
16 Ga0070706_100055442 3300005467 Bacteria 3659
17 Ga0070698_100000995 3300005471 Bacteria 31206
18 Ga0070679_100025901 3300005530 Bacteria 5755
19 Ga0070697_100031884 3300005536 Bacteria 4241
20 Ga0070697_100202370 3300005536 Bacteria 1688
21 Ga0068853_100526748 3300005539 Bacteria 1118
22 Ga0070672_100516156 3300005543 Bacteria 1035
23 Ga0070665_100112487 3300005548 Bacteria 2725
24 Ga0070665_100116433 3300005548 Bacteria 2675
25 Ga0068855_100002011 3300005563 Bacteria 25208
26 Ga0070664_100061744 3300005564 Bacteria 3194
27 Ga0068852_100052944 3300005616 Bacteria 3491
28 Ga0081455_10000211 3300005937 Bacteria 74488
29 Ga0081455_10008167 3300005937 Bacteria 10917
30 Ga0081539_10028298 3300005985 Bacteria 3527
31 Ga0075365_10146304 3300006038 Bacteria 1642
32 Ga0075365_10263294 3300006038 Bacteria 1212
33 Ga0075364_10021050 3300006051 Bacteria 4108
34 Ga0075364_10281753 3300006051 Bacteria 1131
35 Ga0075362_10012875 3300006177 Bacteria 3335
36 Ga0075362_10038888 3300006177 Bacteria 2090
37 Ga0075362_10047980 3300006177 Bacteria 1904
38 Ga0075362_10128422 3300006177 Bacteria 1204
39 Ga0075367_10017323 3300006178 Bacteria 3952
40 Ga0075367_10042291 3300006178 Bacteria 2666
41 Ga0075367_10060733 3300006178 Bacteria 2254
42 Ga0075367_10073000 3300006178 Bacteria 2067
43 Ga0075369_10008144 3300006186 Bacteria 4022
44 Ga0075366_10038798 3300006195 Bacteria 2813
45 Ga0075370_10021794 3300006353 Bacteria 3512
46 Ga0068871_100765955 3300006358 Bacteria 888
47 Ga0079104_1000101 3300006946 Bacteria 125456
48 Ga0099794_10081892 3300007265 Bacteria 1593
49 Ga0099795_10209364 3300007788 Bacteria 826
50 Ga0105240_10008777 3300009093 Bacteria 14404
51 Ga0105240_10233038 3300009093 Bacteria 2138
52 Ga0105238_10263681 3300009551 Bacteria 1703
53 Ga0105249_10551528 3300009553 Bacteria 1203
54 Ga0105239_10132630 3300010375 Bacteria 2772
55 Ga0157373_10148227 3300013100 Bacteria 1651
56 Ga0157371_10096076 3300013102 Bacteria 2100
57 Ga0157369_10019604 3300013105 Bacteria 7568
58 Ga0157369_10106801 3300013105 Bacteria 2979
59 Ga0182008_10082653 3300014497 Bacteria 1581
60 Ga0157376_10130891 3300014969 Bacteria 2239
61 Ga0157376_10977372 3300014969 Bacteria 868
62 Ga0182005_1004062 3300015265 Bacteria 4799
63 Ga0213876_10001559 3300021384 Bacteria 14094
64 Ga0207680_10171926 3300025903 Bacteria 1460
65 Ga0207705_10037705 3300025909 Bacteria 3458
66 Ga0207707_10033690 3300025912 Bacteria 4482
67 Ga0207695_10070839 3300025913 Bacteria 3562
68 Ga0207695_10169576 3300025913 Bacteria 2109
69 Ga0207693_10191688 3300025915 Bacteria 1608
70 Ga0207660_10025714 3300025917 Bacteria 3999
71 Ga0207649_10097086 3300025920 Bacteria 1942
72 Ga0207652_10018280 3300025921 Bacteria 5748
73 Ga0207646_10057565 3300025922 Bacteria 3473
74 Ga0207694_10280360 3300025924 Bacteria 1369
75 Ga0207659_10062769 3300025926 Bacteria 2683
76 Ga0207700_10244647 3300025928 Bacteria 1530
77 Ga0207690_10620063 3300025932 Bacteria 884
78 Ga0207661_10166201 3300025944 Bacteria 1917
79 Ga0207679_10264182 3300025945 Bacteria 1469
80 Ga0207667_10035190 3300025949 Bacteria 5373
81 Ga0207667_10139485 3300025949 Bacteria 2496
82 Ga0207651_10226201 3300025960 Bacteria 1516
83 Ga0207712_10553399 3300025961 Bacteria 990
84 Ga0207639_10376604 3300026041 Bacteria 1274
85 Ga0207639_10601830 3300026041 Bacteria 1014
86 Ga0207674_10058881 3300026116 Bacteria 3889
87 Ga0207674_10109970 3300026116 Bacteria 2731
88 Ga0207683_10073446 3300026121 Bacteria 3026
89 Ga0207683_10103342 3300026121 Bacteria 2545
90 Ga0207698_10044262 3300026142 Bacteria 3343
91 Ga0209813_10036602 3300027866 Bacteria 1475
92 Ga0268266_10107756 3300028379 Bacteria 2464
93 Ga0268266_10122202 3300028379 Bacteria 2318
94 Ga0268264_10102328 3300028381 Bacteria 2492
95 Ga0265328_10016090 3300031239 Bacteria 2916
96 Ga0265327_10034918 3300031251 Bacteria 2785
97 Ga0265316_10040133 3300031344 Bacteria 3754
98 Ga0265314_10033507 3300031711 Bacteria 3765
99 Ga0307510_10187660 3300033180 Bacteria 1620
100 Ga0373923_0113310 3300035111 Bacteria 1206
101 Ga0373945_0087519 3300035116 Bacteria 1202
102 Ga0373955_0275755 3300035172 Bacteria 1011
103 Ga0373931_0046853 3300035691 Bacteria 2287
104 Ga0373927_0078786 3300035695 Bacteria 2134
105 Ga0373933_0331517 3300035724 Bacteria 987
106 Ga0373937_0058754 3300036401 Bacteria 3533
107 Ga0373937_0302113 3300036401 Bacteria 1513
108 Ga0395899_0075228 3300037312 Bacteria 2466
109 Ga0395900_0010059 3300037418 Bacteria 9676
110 Ga0395900_0045221 3300037418 Unclassified 4535
111 Ga0395900_0046043 3300037418 Bacteria 4492
112 Ga0395898_0032518 3300037466 Bacteria 5207
113 Ga0395901_0003328 3300038443 Bacteria 16194
114 Ga0395901_0090886 3300038443 Bacteria 3195
115 Ga0395901_0285001 3300038443 Bacteria 1715
116 Ga0436365_1280371 3300039437 Bacteria 6760
117 Ga0439465_0030804 3300041413 Bacteria 1708
118 Ga0439456_047917 3300042013 Bacteria 932
119 Ga0466965_0115826 3300044683 Bacteria 1381
120 Ga0466963_0037356 3300044694 Bacteria 3170
121 Ga0466971_0161123 3300044719 Bacteria 1050
122 Ga0466967_0048191 3300045976 Bacteria 3719
123 Ga0495654_0000571 3300046530 Bacteria 29572
124 Ga0495657_0324178 3300046675 Bacteria 915
125 Ga0496106_0107156 3300048909 Bacteria 2173
126 Ga0496121_0065626 3300048924 Bacteria 2952
127 Ga0501031_0006302 3300049568 Bacteria 7733
128 Ga0501033_0089298 3300049570 Bacteria 2254
129 Ga0501034_0005733 3300049571 Bacteria 13503
130 Ga0501034_0006231 3300049571 Bacteria 12840
131 Ga0501034_0011723 3300049571 Bacteria 9069
132 Ga0501034_0143504 3300049571 Bacteria 2366
133 Ga0501034_0247029 3300049571 Bacteria 1729
134 Ga0501034_0623069 3300049571 Bacteria 983
135 Ga0501036_0019590 3300049572 Bacteria 5680
136 Ga0501037_0019504 3300049573 Bacteria 5002
137 Ga0501038_0043266 3300049574 Bacteria 3916
138 Ga0501039_0016085 3300049575 Bacteria 5729
139 Ga0501043_0078995 3300049579 Bacteria 2585
140 Ga0501043_0183532 3300049579 Bacteria 1630
141 Ga0501046_0102109 3300049580 Bacteria 2199
142 Ga0501047_0227112 3300049581 Bacteria 1721
143 Ga0501047_0360100 3300049581 Bacteria 1290
144 Ga0501048_0120240 3300049582 Bacteria 1856
145 Ga0501070_0022904 3300049586 Bacteria 5228
146 Ga0501080_0224553 3300049742 Bacteria 1718
147 Ga0501035_0097271 3300049822 Bacteria 2585
148 Ga0501035_0295689 3300049822 Bacteria 1366
149 Ga0501044_0176567 3300049823 Bacteria 2105
150 Ga0501044_0194759 3300049823 Bacteria 1987
151 nmdc:mga03683_3555_c1 3300050489 Bacteria 5049
152 nmdc:mga0yw44_418220_c1 3300050492 Bacteria 907
153 nmdc:mga0k408_111992_c1 3300050493 Bacteria 1613
154 nmdc:mga0k408_9332_c1 3300050493 Bacteria 5287
155 nmdc:mga06z11_242395_c1 3300050494 Bacteria 1059
156 nmdc:mga04h51_103815_c1 3300050495 Bacteria 1039
157 nmdc:mga04h51_43228_c1 3300050495 Bacteria 1481
158 nmdc:mga07m45_51941_c1 3300050496 Bacteria 2313
159 nmdc:mga0qj67_293162_c1 3300050509 Bacteria 1318
160 nmdc:mga0sz30_11396_c1 3300050516 Bacteria 3432
161 nmdc:mga0sz30_81471_c1 3300050516 Bacteria 1401
162 Ga0500643_002911 3300053087 Bacteria 8503
163 Ga0500641_0012341 3300053096 Bacteria 3118
164 Ga0500641_0071204 3300053096 Bacteria 1463
165 Ga0500595_007401 3300053119 Bacteria 4556
166 Ga0500658_0003612 3300053134 Bacteria 5834
167 Ga0500568_0005232 3300053139 Bacteria 6749
168 Ga0500616_0002879 3300053153 Bacteria 13805
169 Ga0500622_0010395 3300053156 Bacteria 5110
170 Ga0501084_0571072 3300054114 Bacteria 956

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050509 nmdc:mga0qj67_293162_c1 nmdc:mga0qj67_293162_c1_14_826 185
2 3300037418 Ga0395900_0045221 Ga0395900_0045221_3079_3768 215
3 3300031239 Ga0265328_10016090 Ga0265328_100160903 228
4 3300031251 Ga0265327_10034918 Ga0265327_100349183 228
5 3300031344 Ga0265316_10040133 Ga0265316_100401332 228
6 iso_pu_bacteria 2522572158 2523103178 228
7 3300005354 Ga0070675_100058701 Ga0070675_1000587014 229
8 3300005456 Ga0070678_100096182 Ga0070678_1000961822 229
9 3300006177 Ga0075362_10047980 Ga0075362_100479803 229
10 3300014969 Ga0157376_10130891 Ga0157376_101308911 229
11 3300021384 Ga0213876_10001559 Ga0213876_1000155911 229
12 3300025903 Ga0207680_10171926 Ga0207680_101719262 229
13 3300025926 Ga0207659_10062769 Ga0207659_100627694 229
14 3300025960 Ga0207651_10226201 Ga0207651_102262012 229
15 3300026121 Ga0207683_10103342 Ga0207683_101033422 229
16 3300028381 Ga0268264_10102328 Ga0268264_101023281 229
17 3300035111 Ga0373923_0113310 Ga0373923_0113310_417_1148 229
18 3300035116 Ga0373945_0087519 Ga0373945_0087519_137_898 229
19 3300035172 Ga0373955_0275755 Ga0373955_0275755_51_782 229
20 3300039437 Ga0436365_1280371 Ga0436365_1280371_3334_4089 229
21 3300048924 Ga0496121_0065626 Ga0496121_0065626_1667_2404 229
22 3300053119 Ga0500595_007401 Ga0500595_007401_1706_2536 229
23 3300053134 Ga0500658_0003612 Ga0500658_0003612_1984_2733 229
24 3300053139 Ga0500568_0005232 Ga0500568_0005232_2178_2933 229
25 iso_pu_bacteria 2821123053 2821128534 229
26 iso_pu_bacteria 2838736955 2838741551 229
27 iso_pu_bacteria 2841840854 2841845614 229
28 iso_pu_bacteria 2842140634 2842145318 229
29 iso_pu_bacteria 2857531043 2857534313 229
30 3300003323 rootH1_10343455 rootH1_103434552 230
31 3300005327 Ga0070658_10001553 Ga0070658_100015535 230
32 3300005327 Ga0070658_10287138 Ga0070658_102871382 230
33 3300005327 Ga0070658_10611188 Ga0070658_106111881 230
34 3300005329 Ga0070683_100002532 Ga0070683_10000253215 230
35 3300005336 Ga0070680_100003649 Ga0070680_10000364913 230
36 3300005339 Ga0070660_100460430 Ga0070660_1004604302 230
37 3300005341 Ga0070691_10003566 Ga0070691_100035667 230
38 3300005344 Ga0070661_100047689 Ga0070661_1000476892 230
39 3300005366 Ga0070659_100175451 Ga0070659_1001754512 230
40 3300005435 Ga0070714_100658959 Ga0070714_1006589591 230
41 3300005458 Ga0070681_10004870 Ga0070681_1000487013 230
42 3300005471 Ga0070698_100000995 Ga0070698_10000099527 230
43 3300005530 Ga0070679_100025901 Ga0070679_1000259015 230
44 3300005536 Ga0070697_100031884 Ga0070697_1000318846 230
45 3300005539 Ga0068853_100526748 Ga0068853_1005267481 230
46 3300005543 Ga0070672_100516156 Ga0070672_1005161562 230
47 3300005548 Ga0070665_100112487 Ga0070665_1001124872 230
48 3300005548 Ga0070665_100116433 Ga0070665_1001164333 230
49 3300005563 Ga0068855_100002011 Ga0068855_10000201113 230
50 3300005564 Ga0070664_100061744 Ga0070664_1000617442 230
51 3300005616 Ga0068852_100052944 Ga0068852_1000529442 230
52 3300005937 Ga0081455_10000211 Ga0081455_1000021147 230
53 3300005937 Ga0081455_10008167 Ga0081455_100081677 230
54 3300006051 Ga0075364_10021050 Ga0075364_100210503 230
55 3300006051 Ga0075364_10281753 Ga0075364_102817532 230
56 3300006177 Ga0075362_10012875 Ga0075362_100128752 230
57 3300006177 Ga0075362_10128422 Ga0075362_101284222 230
58 3300006178 Ga0075367_10073000 Ga0075367_100730002 230
59 3300006195 Ga0075366_10038798 Ga0075366_100387984 230
60 3300006358 Ga0068871_100765955 Ga0068871_1007659551 230
61 3300006946 Ga0079104_1000101 Ga0079104_10001013 230
62 3300007265 Ga0099794_10081892 Ga0099794_100818922 230
63 3300007788 Ga0099795_10209364 Ga0099795_102093641 230
64 3300009093 Ga0105240_10008777 Ga0105240_1000877715 230
65 3300009093 Ga0105240_10233038 Ga0105240_102330382 230
66 3300009551 Ga0105238_10263681 Ga0105238_102636812 230
67 3300009553 Ga0105249_10551528 Ga0105249_105515282 230
68 3300010375 Ga0105239_10132630 Ga0105239_101326302 230
69 3300013100 Ga0157373_10148227 Ga0157373_101482271 230
70 3300013102 Ga0157371_10096076 Ga0157371_100960762 230
71 3300013105 Ga0157369_10019604 Ga0157369_100196043 230
72 3300013105 Ga0157369_10106801 Ga0157369_101068013 230
73 3300014497 Ga0182008_10082653 Ga0182008_100826532 230
74 3300014969 Ga0157376_10977372 Ga0157376_109773721 230
75 3300015265 Ga0182005_1004062 Ga0182005_10040626 230
76 3300025909 Ga0207705_10037705 Ga0207705_100377052 230
77 3300025912 Ga0207707_10033690 Ga0207707_100336905 230
78 3300025913 Ga0207695_10070839 Ga0207695_100708393 230
79 3300025913 Ga0207695_10169576 Ga0207695_101695762 230
80 3300025915 Ga0207693_10191688 Ga0207693_101916882 230
81 3300025917 Ga0207660_10025714 Ga0207660_100257143 230
82 3300025920 Ga0207649_10097086 Ga0207649_100970862 230
83 3300025921 Ga0207652_10018280 Ga0207652_100182803 230
84 3300025922 Ga0207646_10057565 Ga0207646_100575654 230
85 3300025924 Ga0207694_10280360 Ga0207694_102803602 230
86 3300025928 Ga0207700_10244647 Ga0207700_102446472 230
87 3300025932 Ga0207690_10620063 Ga0207690_106200631 230
88 3300025944 Ga0207661_10166201 Ga0207661_101662012 230
89 3300025945 Ga0207679_10264182 Ga0207679_102641822 230
90 3300025949 Ga0207667_10035190 Ga0207667_100351903 230
91 3300025949 Ga0207667_10139485 Ga0207667_101394852 230
92 3300025961 Ga0207712_10553399 Ga0207712_105533991 230
93 3300026041 Ga0207639_10376604 Ga0207639_103766042 230
94 3300026041 Ga0207639_10601830 Ga0207639_106018302 230
95 3300026116 Ga0207674_10058881 Ga0207674_100588816 230
96 3300026116 Ga0207674_10109970 Ga0207674_101099702 230
97 3300026121 Ga0207683_10073446 Ga0207683_100734462 230
98 3300026142 Ga0207698_10044262 Ga0207698_100442622 230
99 3300028379 Ga0268266_10107756 Ga0268266_101077562 230
100 3300028379 Ga0268266_10122202 Ga0268266_101222021 230
101 3300031711 Ga0265314_10033507 Ga0265314_100335073 230
102 3300033180 Ga0307510_10187660 Ga0307510_101876601 230
103 3300035691 Ga0373931_0046853 Ga0373931_0046853_557_1306 230
104 3300035695 Ga0373927_0078786 Ga0373927_0078786_678_1424 230
105 3300035724 Ga0373933_0331517 Ga0373933_0331517_50_799 230
106 3300036401 Ga0373937_0058754 Ga0373937_0058754_2265_3032 230
107 3300036401 Ga0373937_0302113 Ga0373937_0302113_318_1082 230
108 3300037418 Ga0395900_0010059 Ga0395900_0010059_7797_8561 230
109 3300037466 Ga0395898_0032518 Ga0395898_0032518_3698_4462 230
110 3300038443 Ga0395901_0090886 Ga0395901_0090886_1614_2378 230
111 3300038443 Ga0395901_0285001 Ga0395901_0285001_747_1511 230
112 3300041413 Ga0439465_0030804 Ga0439465_0030804_161_910 230
113 3300044683 Ga0466965_0115826 Ga0466965_0115826_522_1262 230
114 3300044694 Ga0466963_0037356 Ga0466963_0037356_1009_1773 230
115 3300044719 Ga0466971_0161123 Ga0466971_0161123_173_937 230
116 3300045976 Ga0466967_0048191 Ga0466967_0048191_800_1564 230
117 3300046530 Ga0495654_0000571 Ga0495654_0000571_627_1382 230
118 3300046675 Ga0495657_0324178 Ga0495657_0324178_123_890 230
119 3300048909 Ga0496106_0107156 Ga0496106_0107156_593_1330 230
120 3300049568 Ga0501031_0006302 Ga0501031_0006302_3299_4036 230
121 3300049570 Ga0501033_0089298 Ga0501033_0089298_946_1683 230
122 3300049571 Ga0501034_0005733 Ga0501034_0005733_11723_12487 230
123 3300049571 Ga0501034_0006231 Ga0501034_0006231_6186_6950 230
124 3300049571 Ga0501034_0143504 Ga0501034_0143504_1362_2126 230
125 3300049571 Ga0501034_0247029 Ga0501034_0247029_691_1431 230
126 3300049572 Ga0501036_0019590 Ga0501036_0019590_3806_4543 230
127 3300049573 Ga0501037_0019504 Ga0501037_0019504_213_950 230
128 3300049574 Ga0501038_0043266 Ga0501038_0043266_1073_1810 230
129 3300049575 Ga0501039_0016085 Ga0501039_0016085_1256_1993 230
130 3300049579 Ga0501043_0078995 Ga0501043_0078995_733_1470 230
131 3300049579 Ga0501043_0183532 Ga0501043_0183532_133_897 230
132 3300049580 Ga0501046_0102109 Ga0501046_0102109_659_1396 230
133 3300049581 Ga0501047_0227112 Ga0501047_0227112_725_1489 230
134 3300049581 Ga0501047_0360100 Ga0501047_0360100_462_1199 230
135 3300049582 Ga0501048_0120240 Ga0501048_0120240_797_1534 230
136 3300049586 Ga0501070_0022904 Ga0501070_0022904_2385_3122 230
137 3300049742 Ga0501080_0224553 Ga0501080_0224553_186_950 230
138 3300049822 Ga0501035_0097271 Ga0501035_0097271_1116_1853 230
139 3300049822 Ga0501035_0295689 Ga0501035_0295689_365_1129 230
140 3300049823 Ga0501044_0176567 Ga0501044_0176567_1000_1743 230
141 3300049823 Ga0501044_0194759 Ga0501044_0194759_782_1519 230
142 3300050493 nmdc:mga0k408_9332_c1 nmdc:mga0k408_9332_c1_2501_3262 230
143 3300050516 nmdc:mga0sz30_81471_c1 nmdc:mga0sz30_81471_c1_604_1374 230
144 3300053087 Ga0500643_002911 Ga0500643_002911_1952_2707 230
145 3300053096 Ga0500641_0012341 Ga0500641_0012341_940_1692 230
146 3300053096 Ga0500641_0071204 Ga0500641_0071204_673_1431 230
147 3300053156 Ga0500622_0010395 Ga0500622_0010395_2504_3259 230
148 iso_pu_bacteria 2597490356 2599102266 230
149 iso_pu_bacteria 2939669807 2939674521 230
150 3300042013 Ga0439456_047917 Ga0439456_047917_92_862 232
151 3300049571 Ga0501034_0623069 Ga0501034_0623069_55_810 232
152 3300005467 Ga0070706_100055442 Ga0070706_1000554423 234
153 3300005536 Ga0070697_100202370 Ga0070697_1002023702 234
154 3300005985 Ga0081539_10028298 Ga0081539_100282983 234
155 3300006038 Ga0075365_10146304 Ga0075365_101463042 234
156 3300006038 Ga0075365_10263294 Ga0075365_102632941 234
157 3300006177 Ga0075362_10038888 Ga0075362_100388881 234
158 3300006178 Ga0075367_10017323 Ga0075367_100173232 234
159 3300006178 Ga0075367_10042291 Ga0075367_100422914 234
160 3300006178 Ga0075367_10060733 Ga0075367_100607334 234
161 3300006186 Ga0075369_10008144 Ga0075369_100081446 234
162 3300006353 Ga0075370_10021794 Ga0075370_100217942 234
163 3300027866 Ga0209813_10036602 Ga0209813_100366022 234
164 3300037312 Ga0395899_0075228 Ga0395899_0075228_1157_1939 234
165 3300037418 Ga0395900_0046043 Ga0395900_0046043_2374_3156 234
166 3300038443 Ga0395901_0003328 Ga0395901_0003328_4815_5597 234
167 3300049571 Ga0501034_0011723 Ga0501034_0011723_4937_5698 234
168 3300050489 nmdc:mga03683_3555_c1 nmdc:mga03683_3555_c1_4197_4985 234
169 3300050492 nmdc:mga0yw44_418220_c1 nmdc:mga0yw44_418220_c1_37_825 234
170 3300050493 nmdc:mga0k408_111992_c1 nmdc:mga0k408_111992_c1_187_975 234
171 3300050494 nmdc:mga06z11_242395_c1 nmdc:mga06z11_242395_c1_53_841 234
172 3300050495 nmdc:mga04h51_103815_c1 nmdc:mga04h51_103815_c1_79_849 234
173 3300050495 nmdc:mga04h51_43228_c1 nmdc:mga04h51_43228_c1_268_1056 234
174 3300050496 nmdc:mga07m45_51941_c1 nmdc:mga07m45_51941_c1_429_1217 234
175 3300050516 nmdc:mga0sz30_11396_c1 nmdc:mga0sz30_11396_c1_1176_1964 234
176 3300053153 Ga0500616_0002879 Ga0500616_0002879_6484_7266 234
177 3300054114 Ga0501084_0571072 Ga0501084_0571072_43_819 234
178 3300003323 rootH1_10221818 rootH1_102218182 253

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

97

191

0.97

PF13649

Methyltransf_25

Methyltransferase domain

96

187

0.96

PF08242

Methyltransf_12

Methyltransferase domain

97

189

0.88

PF05401

NodS

Nodulation protein S (NodS)

75

245

0.87

PF06325

PrmA

Ribosomal protein L11 methyltransferase (PrmA)

84

199

0.86

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

75

217

0.85

PF13847

Methyltransf_31

Methyltransferase domain

90

247

0.85

PF02353

CMAS

Mycolic acid cyclopropane synthetase

75

221

0.83

PF13489

Methyltransf_23

Methyltransferase domain

69

244

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kdr-assembly1.cif.gz_A crystal structure of ubig/sah complex 0.9413 5 167
6mro-assembly1.cif.gz_A crystal structure of methyl transferase from methanosarcina acetivorans at 1.6 angstroms resolution, northeast structural genomics consortium (nesg) target mvr53. 0.9313 64 161
3bus-assembly2.cif.gz_B crystal structure of rebm 0.9192 61 163
1xxl-assembly2.cif.gz_B the crystal structure of ycgj protein from bacillus subitilis at 2.1 a resolution 0.9081 60 163
4kdc-assembly1.cif.gz_A crystal structure of ubig 0.8924 11 167
ID Description Score Start End Superfamily
af_Q0DEH3_59_207_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9646 1 130 3.40.50.150
af_B7ZXR6_266_358_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9439 61 115 3.40.50.150
4kdrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9413 5 167 3.40.50.150
af_A4HXF2_86_160_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9336 60 107 3.40.50.150
af_A0A1D6FP61_65_209_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9324 2 113 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A401TYT8-F1-model_v4 Uncharacterized protein 0.99 2 115 GO:0010420
GO:0032259
GO:0061542
AF-A0A436QMN1-F1-model_v4 3-demethylubiquinone-9 3-O-methyltransferase 0.9832 1 111 GO:0010420
GO:0032259
GO:0061542
AF-A0A3B9EMP0-F1-model_v4 3-demethylubiquinone-9 3-O-methyltransferase 0.982 1 155 GO:0010420
GO:0032259
GO:0061542
AF-A0A2K3P2A0-F1-model_v4 Hexaprenyldihydroxybenzoate methyltransferase mitochondrial-like 0.9795 2 102 GO:0005740
GO:0010420
GO:0032259
GO:0061542
AF-D7TR93-F1-model_v4 Methyltransferase domain-containing protein 0.9762 2 102 GO:0005737
GO:0010420
GO:0032259
GO:0061542

Feature Viewer

pLDDT pTM Quality
68.55 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map