F272785

General Info

Members Datasets Scaffolds Average Seq Length
178 115 356 447

Family's Representative Sequence

Representative Sequence 3300049592|Ga0501076_0139379|Ga0501076_0139379_226_1671
Length 481
Sequence MILGAAPRLYQQALAGRPRHFAQEGAMSAEKSQVNASAVRGLAERFAGELVLPGDAGYDSARAVWNGMIDRRPAVVARPVAADDVATAIRFARERDLPLAVKAGGHSIPGLSTCDDGVVIDLSLMRGARVDAERRTAEVNGGALLGELDDAAQAAGLVCPVGVVSHTGVAGLTLGGGMGRLQRKFGLTIDNLLSVDLVTADGRLVRASEDENPDLFWGLRGAGANFGVATSFRFRLHPLERTITFGSVVHXXERAREAAQLYRELIETGPDEVWGSFTLGHEGGRPVATIGVTHCGPLDAAERDLAPLRSFGPPIEDSIAPKPYLDVQRMNDEPQAWGHRFYMKSGFLAAFPDELVDICVEAVSRAPDGVECGIYLWSCGRAYSAVPDEAMAFSGRDAAFWFEAEALWEDAAQDEASRAWTRATMDQVQPFTSAGRYVNDLAEAGEDLVSVYGGAKYERLVALKRLWDPDNVFRLNQNIRP

Samples

Sample ID Description Type Environment
1 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
20 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
35 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
47 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
48 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
49 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
50 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
51 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
52 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
53 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
54 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
55 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
56 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
57 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
58 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
59 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
60 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
61 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
62 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
63 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
64 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
65 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
66 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
67 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
68 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
69 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
70 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
71 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
72 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
73 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
74 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
75 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
76 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
77 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
78 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
79 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
92 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
93 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
94 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
95 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
96 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
97 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
98 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
99 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
100 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
101 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
102 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
105 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
106 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
107 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
108 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
109 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
110 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
111 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
112 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
113 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
114 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
115 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.88
Metatranscriptomes 0
Isolates 1.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 8.43
Rhizosphere 89.89
Stem 0
Stem Tuber 0
Unclassified 1.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501076_0139379 3300049592 Bacteria 1970
2 JGI25407J50210_10003925 3300003373 Bacteria 3604
3 JGI25407J50210_10008851 3300003373 Bacteria 2543
4 Ga0070683_100000696 3300005329 Bacteria 24416
5 Ga0070683_100014602 3300005329 Bacteria 6876
6 Ga0070690_100106634 3300005330 Bacteria 1864
7 Ga0070690_100157730 3300005330 Bacteria 1553
8 Ga0070667_100012565 3300005367 Bacteria 7002
9 Ga0070709_10027989 3300005434 Bacteria 3357
10 Ga0070713_100042422 3300005436 Bacteria 3713
11 Ga0070710_10022488 3300005437 Bacteria 3298
12 Ga0070708_100003711 3300005445 Bacteria 11972
13 Ga0070708_100060366 3300005445 Bacteria 3384
14 Ga0070708_100120377 3300005445 Bacteria 2421
15 Ga0070706_100037180 3300005467 Unclassified 4496
16 Ga0070707_100003257 3300005468 Bacteria 15390
17 Ga0070707_100010926 3300005468 Bacteria 8454
18 Ga0070698_100015383 3300005471 Bacteria 8085
19 Ga0070698_100029759 3300005471 Bacteria 5667
20 Ga0070684_100000747 3300005535 Bacteria 22528
21 Ga0070697_100004709 3300005536 Bacteria 10457
22 Ga0070696_100027720 3300005546 Bacteria 3862
23 Ga0070693_100016962 3300005547 Bacteria 3778
24 Ga0068857_100003106 3300005577 Bacteria 13742
25 Ga0081455_10013537 3300005937 Bacteria 8043
26 Ga0081455_10055743 3300005937 Bacteria 3361
27 Ga0081455_10173104 3300005937 Bacteria 1642
28 Ga0081538_10000258 3300005981 Bacteria 60142
29 Ga0081538_10001027 3300005981 Bacteria 29805
30 Ga0081538_10008457 3300005981 Bacteria 8728
31 Ga0081538_10029522 3300005981 Bacteria 3744
32 Ga0081538_10050056 3300005981 Bacteria 2528
33 Ga0081540_1002141 3300005983 Bacteria 16431
34 Ga0081540_1010910 3300005983 Bacteria 6101
35 Ga0081540_1038548 3300005983 Bacteria 2517
36 Ga0081539_10006410 3300005985 Bacteria 11308
37 Ga0081539_10060021 3300005985 Bacteria 2090
38 Ga0070712_100032995 3300006175 Bacteria 3499
39 Ga0075430_100019992 3300006846 Bacteria 5699
40 Ga0075431_100153045 3300006847 Bacteria 2374
41 Ga0075434_100405605 3300006871 Bacteria 1384
42 Ga0075429_100082909 3300006880 Bacteria 2795
43 Ga0105240_10361488 3300009093 Bacteria 1644
44 Ga0111539_10132574 3300009094 Bacteria 2918
45 Ga0111539_10698940 3300009094 Bacteria 1180
46 Ga0105245_10069949 3300009098 Bacteria 3183
47 Ga0114129_10016333 3300009147 Bacteria 10568
48 Ga0114129_10019779 3300009147 Bacteria 9584
49 Ga0114129_10054500 3300009147 Bacteria 5606
50 Ga0105243_10040726 3300009148 Bacteria 3630
51 Ga0105243_10057348 3300009148 Bacteria 3101
52 Ga0105242_10006047 3300009176 Bacteria 9330
53 Ga0105239_10085721 3300010375 Bacteria 3472
54 Ga0157378_10007831 3300013297 Bacteria 9326
55 Ga0207684_10000265 3300025910 Bacteria 77583
56 Ga0207693_10022723 3300025915 Bacteria 4982
57 Ga0207693_10035399 3300025915 Bacteria 3937
58 Ga0207663_10036279 3300025916 Bacteria 2965
59 Ga0207652_10082055 3300025921 Bacteria 2821
60 Ga0207646_10019721 3300025922 Bacteria 6259
61 Ga0207646_10032670 3300025922 Bacteria 4709
62 Ga0207646_10137805 3300025922 Unclassified 2197
63 Ga0207664_10005467 3300025929 Bacteria 8688
64 Ga0207665_10000831 3300025939 Bacteria 20900
65 Ga0207661_10155150 3300025944 Bacteria 1982
66 Ga0207658_10015525 3300025986 Bacteria 5225
67 Ga0207674_10001212 3300026116 Bacteria 33568
68 Ga0207683_10004193 3300026121 Bacteria 12465
69 Ga0207428_10014149 3300027907 Bacteria 6947
70 Ga0307516_10000130 3300031730 Bacteria 89368
71 Ga0307516_10122537 3300031730 Bacteria 2388
72 Ga0307413_10068114 3300031824 Bacteria 2228
73 Ga0307410_10130808 3300031852 Bacteria 1843
74 Ga0307415_100048246 3300032126 Bacteria 2872
75 Ga0373948_0002921 3300034817 Bacteria 2578
76 Ga0373940_0003974 3300035088 Bacteria 3084
77 Ga0373961_0019469 3300035241 Bacteria 1784
78 Ga0373947_0024068 3300035725 Bacteria 3546
79 Ga0395900_0002691 3300037418 Bacteria 19417
80 Ga0395900_0006792 3300037418 Bacteria 11874
81 Ga0395900_0020284 3300037418 Bacteria 6784
82 Ga0395900_0125958 3300037418 Bacteria 2627
83 Ga0395900_0251570 3300037418 Bacteria 1768
84 Ga0395898_0007825 3300037466 Bacteria 11346
85 Ga0395898_0007875 3300037466 Bacteria 11304
86 Ga0395898_0047493 3300037466 Bacteria 4213
87 Ga0395898_0178699 3300037466 Bacteria 2028
88 Ga0395905_0005212 3300037471 Bacteria 13307
89 Ga0395905_0062932 3300037471 Bacteria 3470
90 Ga0395901_0007618 3300038443 Bacteria 10930
91 Ga0395901_0016162 3300038443 Bacteria 7601
92 Ga0395901_0023640 3300038443 Bacteria 6301
93 Ga0395901_0095565 3300038443 Bacteria 3114
94 Ga0395901_0145372 3300038443 Bacteria 2492
95 Ga0466963_0015090 3300044694 Bacteria 4776
96 Ga0466958_0003304 3300045836 Bacteria 8347
97 Ga0466967_0239187 3300045976 Bacteria 1731
98 Ga0495603_0016788 3300046455 Bacteria 4429
99 Ga0495629_0061703 3300046459 Bacteria 2620
100 Ga0495651_0019022 3300046462 Bacteria 5322
101 Ga0495634_0034327 3300046642 Bacteria 3482
102 Ga0495624_0074219 3300046690 Bacteria 2114
103 Ga0495674_0050026 3300047319 Bacteria 3689
104 Ga0495676_0163080 3300047321 Bacteria 1575
105 Ga0496100_0024951 3300048903 Bacteria 3651
106 Ga0496102_0027992 3300048905 Bacteria 5035
107 Ga0496102_0088201 3300048905 Bacteria 2867
108 Ga0496103_0006792 3300048906 Bacteria 6829
109 Ga0496106_0010054 3300048909 Bacteria 6989
110 Ga0496106_0163558 3300048909 Bacteria 1761
111 Ga0496107_0002639 3300048910 Bacteria 11726
112 Ga0496109_0088626 3300048912 Bacteria 2860
113 Ga0496110_0030594 3300048913 Bacteria 4641
114 Ga0496110_0048292 3300048913 Bacteria 3731
115 Ga0496111_0024553 3300048914 Bacteria 4246
116 Ga0496111_0097225 3300048914 Bacteria 2161
117 Ga0496113_0068156 3300048916 Bacteria 2700
118 Ga0496113_0154281 3300048916 Bacteria 1813
119 Ga0496114_0104231 3300048917 Bacteria 2425
120 Ga0501031_0000361 3300049568 Bacteria 26511
121 Ga0501031_0012471 3300049568 Bacteria 5545
122 Ga0501033_0009134 3300049570 Bacteria 7644
123 Ga0501033_0072592 3300049570 Bacteria 2527
124 Ga0501036_0005410 3300049572 Bacteria 10347
125 Ga0501037_0028614 3300049573 Bacteria 4116
126 Ga0501037_0068932 3300049573 Bacteria 2575
127 Ga0501038_0036115 3300049574 Bacteria 4337
128 Ga0501038_0085522 3300049574 Bacteria 2652
129 Ga0501039_0005414 3300049575 Bacteria 9654
130 Ga0501039_0021893 3300049575 Bacteria 4904
131 Ga0501039_0135259 3300049575 Bacteria 1935
132 Ga0501040_0001294 3300049576 Bacteria 15940
133 Ga0501041_0015994 3300049577 Bacteria 4458
134 Ga0501042_0001700 3300049578 Bacteria 13139
135 Ga0501042_0023857 3300049578 Bacteria 4284
136 Ga0501043_0008018 3300049579 Bacteria 8337
137 Ga0501046_0003401 3300049580 Bacteria 14604
138 Ga0501046_0036244 3300049580 Bacteria 3971
139 Ga0501048_0001421 3300049582 Bacteria 18130
140 Ga0501048_0031227 3300049582 Bacteria 3853
141 Ga0501068_0020076 3300049584 Bacteria 3888
142 Ga0501069_0002798 3300049585 Bacteria 8921
143 Ga0501070_0014807 3300049586 Bacteria 6564
144 Ga0501071_0001002 3300049587 Bacteria 15511
145 Ga0501072_0010679 3300049588 Bacteria 6992
146 Ga0501072_0116219 3300049588 Bacteria 2130
147 Ga0501074_0004206 3300049590 Bacteria 10288
148 Ga0501075_0009643 3300049591 Bacteria 6761
149 Ga0501075_0022370 3300049591 Bacteria 4616
150 Ga0501076_0004068 3300049592 Bacteria 10341
151 Ga0501076_0008211 3300049592 Bacteria 7648
152 Ga0501079_0034115 3300049741 Bacteria 3915
153 Ga0501079_0034510 3300049741 Bacteria 3892
154 Ga0501079_0156396 3300049741 Bacteria 1777
155 Ga0501080_0046394 3300049742 Bacteria 4045
156 Ga0501081_0003651 3300049743 Bacteria 9854
157 Ga0501081_0015864 3300049743 Bacteria 4973
158 Ga0501083_0006016 3300049744 Bacteria 8595
159 Ga0501035_0028596 3300049822 Bacteria 5088
160 Ga0501044_0036539 3300049823 Bacteria 5140
161 Ga0501045_0014738 3300049824 Bacteria 5542
162 Ga0501045_0019882 3300049824 Bacteria 4793
163 nmdc:mga05p37_16620_c1 3300050507 Bacteria 8863
164 nmdc:mga05p37_58638_c1 3300050507 Bacteria 4741
165 nmdc:mga09592_104319_c1 3300050508 Bacteria 2429
166 nmdc:mga08y16_180429_c1 3300050511 Bacteria 2192
167 nmdc:mga08y16_38591_c1 3300050511 Bacteria 5014
168 nmdc:mga0n895_56011_c1 3300050512 Bacteria 3883
169 nmdc:mga0rr50_242845_c1 3300050513 Bacteria 1493
170 nmdc:mga0rr50_59216_c1 3300050513 Bacteria 2875
171 nmdc:mga0a205_236254_c1 3300050515 Bacteria 1710
172 nmdc:mga0sz30_9114_c1 3300050516 Bacteria 3764
173 Ga0501084_0010463 3300054114 Bacteria 7666
174 Ga0501084_0027531 3300054114 Bacteria 4749
175 Ga0530510_0031967 3300061734 Bacteria 3784
176 Ga0530510_0182643 3300061734 Bacteria 1556
177 2585254826 2582581304 Bacteria 5831370
178 2997452702 2997451912 Bacteria 8492419
179 Ga0501076_0139379
180 JGI25407J50210_10003925
181 JGI25407J50210_10008851
182 Ga0070683_100000696
183 Ga0070683_100014602
184 Ga0070690_100106634
185 Ga0070690_100157730
186 Ga0070667_100012565
187 Ga0070709_10027989
188 Ga0070713_100042422
189 Ga0070710_10022488
190 Ga0070708_100003711
191 Ga0070708_100060366
192 Ga0070708_100120377
193 Ga0070706_100037180
194 Ga0070707_100003257
195 Ga0070707_100010926
196 Ga0070698_100015383
197 Ga0070698_100029759
198 Ga0070684_100000747
199 Ga0070697_100004709
200 Ga0070696_100027720
201 Ga0070693_100016962
202 Ga0068857_100003106
203 Ga0081455_10013537
204 Ga0081455_10055743
205 Ga0081455_10173104
206 Ga0081538_10000258
207 Ga0081538_10001027
208 Ga0081538_10008457
209 Ga0081538_10029522
210 Ga0081538_10050056
211 Ga0081540_1002141
212 Ga0081540_1010910
213 Ga0081540_1038548
214 Ga0081539_10006410
215 Ga0081539_10060021
216 Ga0070712_100032995
217 Ga0075430_100019992
218 Ga0075431_100153045
219 Ga0075434_100405605
220 Ga0075429_100082909
221 Ga0105240_10361488
222 Ga0111539_10132574
223 Ga0111539_10698940
224 Ga0105245_10069949
225 Ga0114129_10016333
226 Ga0114129_10019779
227 Ga0114129_10054500
228 Ga0105243_10040726
229 Ga0105243_10057348
230 Ga0105242_10006047
231 Ga0105239_10085721
232 Ga0157378_10007831
233 Ga0207684_10000265
234 Ga0207693_10022723
235 Ga0207693_10035399
236 Ga0207663_10036279
237 Ga0207652_10082055
238 Ga0207646_10019721
239 Ga0207646_10032670
240 Ga0207646_10137805
241 Ga0207664_10005467
242 Ga0207665_10000831
243 Ga0207661_10155150
244 Ga0207658_10015525
245 Ga0207674_10001212
246 Ga0207683_10004193
247 Ga0207428_10014149
248 Ga0307516_10000130
249 Ga0307516_10122537
250 Ga0307413_10068114
251 Ga0307410_10130808
252 Ga0307415_100048246
253 Ga0373948_0002921
254 Ga0373940_0003974
255 Ga0373961_0019469
256 Ga0373947_0024068
257 Ga0395900_0002691
258 Ga0395900_0006792
259 Ga0395900_0020284
260 Ga0395900_0125958
261 Ga0395900_0251570
262 Ga0395898_0007825
263 Ga0395898_0007875
264 Ga0395898_0047493
265 Ga0395898_0178699
266 Ga0395905_0005212
267 Ga0395905_0062932
268 Ga0395901_0007618
269 Ga0395901_0016162
270 Ga0395901_0023640
271 Ga0395901_0095565
272 Ga0395901_0145372
273 Ga0466963_0015090
274 Ga0466958_0003304
275 Ga0466967_0239187
276 Ga0495603_0016788
277 Ga0495629_0061703
278 Ga0495651_0019022
279 Ga0495634_0034327
280 Ga0495624_0074219
281 Ga0495674_0050026
282 Ga0495676_0163080
283 Ga0496100_0024951
284 Ga0496102_0027992
285 Ga0496102_0088201
286 Ga0496103_0006792
287 Ga0496106_0010054
288 Ga0496106_0163558
289 Ga0496107_0002639
290 Ga0496109_0088626
291 Ga0496110_0030594
292 Ga0496110_0048292
293 Ga0496111_0024553
294 Ga0496111_0097225
295 Ga0496113_0068156
296 Ga0496113_0154281
297 Ga0496114_0104231
298 Ga0501031_0000361
299 Ga0501031_0012471
300 Ga0501033_0009134
301 Ga0501033_0072592
302 Ga0501036_0005410
303 Ga0501037_0028614
304 Ga0501037_0068932
305 Ga0501038_0036115
306 Ga0501038_0085522
307 Ga0501039_0005414
308 Ga0501039_0021893
309 Ga0501039_0135259
310 Ga0501040_0001294
311 Ga0501041_0015994
312 Ga0501042_0001700
313 Ga0501042_0023857
314 Ga0501043_0008018
315 Ga0501046_0003401
316 Ga0501046_0036244
317 Ga0501048_0001421
318 Ga0501048_0031227
319 Ga0501068_0020076
320 Ga0501069_0002798
321 Ga0501070_0014807
322 Ga0501071_0001002
323 Ga0501072_0010679
324 Ga0501072_0116219
325 Ga0501074_0004206
326 Ga0501075_0009643
327 Ga0501075_0022370
328 Ga0501076_0004068
329 Ga0501076_0008211
330 Ga0501079_0034115
331 Ga0501079_0034510
332 Ga0501079_0156396
333 Ga0501080_0046394
334 Ga0501081_0003651
335 Ga0501081_0015864
336 Ga0501083_0006016
337 Ga0501035_0028596
338 Ga0501044_0036539
339 Ga0501045_0014738
340 Ga0501045_0019882
341 nmdc:mga05p37_16620_c1
342 nmdc:mga05p37_58638_c1
343 nmdc:mga09592_104319_c1
344 nmdc:mga08y16_180429_c1
345 nmdc:mga08y16_38591_c1
346 nmdc:mga0n895_56011_c1
347 nmdc:mga0rr50_242845_c1
348 nmdc:mga0rr50_59216_c1
349 nmdc:mga0a205_236254_c1
350 nmdc:mga0sz30_9114_c1
351 Ga0501084_0010463
352 Ga0501084_0027531
353 Ga0530510_0031967
354 Ga0530510_0182643
355 2585254826
356 2997452702

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01565

FAD_binding_4

FAD binding domain

73

208

0.98

PF08031

BBE

Berberine and berberine like

437

480

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fye-assembly1.cif.gz_B-2 the crystal structure of encm h138t mutant 0.9514 1 446
6fyg-assembly1.cif.gz_A the crystal structure of encm v135t mutant 0.9502 1 446
6fyb-assembly1.cif.gz_A the crystal structure of encm l144m mutant 0.9498 1 446
6fye-assembly1.cif.gz_B-2 the crystal structure of encm h138t mutant 0.9493 1 446
4xlo-assembly1.cif.gz_C crystal structure of encm (crystallized with 4 mm nadph) 0.9482 2 446
ID Description Score Start End Superfamily
3w8xA02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9901 94 204 3.30.465.10
3w8wB01 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.9876 15 92 3.30.43.10
af_Q869M2_98_203_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9814 102 206 3.30.465.10
2bvfB02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9779 94 205 3.30.465.10
2bvfA01 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.975 15 92 3.30.43.10
ID Description Score Start End GO Terms
AF-A0A7C5RT92-F1-model_v4 FAD-binding oxidoreductase 0.9855 6 207 GO:0016491
GO:0071949
AF-A0A383D8V0-F1-model_v4 FAD-binding PCMH-type domain-containing protein 0.985 1 179 GO:0071949
AF-A0A3M1AI68-F1-model_v4 FAD-binding oxidoreductase 0.9794 1 166 GO:0016491
GO:0071949
AF-A0A536JWE6-F1-model_v4 FAD-binding oxidoreductase 0.9756 10 446 GO:0016491
GO:0071949
AF-A0A536HA54-F1-model_v4 FAD-binding oxidoreductase 0.9754 43 446 GO:0016491
GO:0071949

Map