F272493

General Info

Members Datasets Scaffolds Average Seq Length
178 117 356 223

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0036908|Ga0451576_0036908_404_1132
Length 242
Sequence MRFADMEVTMSTQTINEDATQTRTPAAANLKLEVVVIPVADVDRAKRFYEGLGWRVDADFANGDDWRLVQLTPPGSPCSVMFGKGFTNAVPGSVQGTFLAVDNIDTARAELVGRGVDMSEVFHFEGDRLVVDTRERAPGRDPKGRSYLSFASFSDPDGNSWLLQEINGRLPGRGLSVDLATMTVLLRETEERHGQYEPTAPKHHWSQWYAAYMVARVRGRTPDEAAIDGARNVEGSREGVRV

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
65 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
66 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
67 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
68 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
69 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
70 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
73 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
74 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
75 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
76 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
77 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
78 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
79 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
80 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
81 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
82 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
83 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
84 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
85 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
95 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
96 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
97 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
98 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
99 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
100 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
101 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
102 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
103 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
104 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
105 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
106 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
107 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
108 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
109 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
110 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
111 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
112 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
113 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
114 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
115 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
116 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
117 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 1.12
Rhizosphere 97.75
Stem 0
Stem Tuber 0
Unclassified 3.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0036908 3300045051 Bacteria 5178
2 Ga0065712_10000354 3300005290 Bacteria 15286
3 Ga0065712_10095727 3300005290 Bacteria 2201
4 Ga0065715_10004419 3300005293 Bacteria 4354
5 Ga0065715_10162351 3300005293 Bacteria 1577
6 Ga0065707_10110206 3300005295 Bacteria 2439
7 Ga0070670_100177708 3300005331 Bacteria 1848
8 Ga0070670_100261433 3300005331 Bacteria 1509
9 Ga0068868_100098930 3300005338 Bacteria 2359
10 Ga0070661_100041390 3300005344 Bacteria 3363
11 Ga0070668_100149100 3300005347 Bacteria 1890
12 Ga0070675_100047813 3300005354 Bacteria 3506
13 Ga0070675_100079434 3300005354 Bacteria 2733
14 Ga0070675_100139187 3300005354 Bacteria 2073
15 Ga0070671_100122971 3300005355 Bacteria 2184
16 Ga0070673_100009727 3300005364 Bacteria 6470
17 Ga0070673_100293613 3300005364 Bacteria 1429
18 Ga0070667_100553145 3300005367 Bacteria 1058
19 Ga0070703_10093971 3300005406 Bacteria 1045
20 Ga0070705_100226933 3300005440 Bacteria 1297
21 Ga0070663_100206704 3300005455 Bacteria 1535
22 Ga0070706_100462336 3300005467 Bacteria 1181
23 Ga0070707_100112581 3300005468 Bacteria 2640
24 Ga0070698_100174036 3300005471 Bacteria 2092
25 Ga0070699_100202257 3300005518 Bacteria 1767
26 Ga0070697_100367466 3300005536 Bacteria 1244
27 Ga0070695_100038593 3300005545 Bacteria 3015
28 Ga0070665_100209324 3300005548 Bacteria 1951
29 Ga0070704_100098730 3300005549 Bacteria 2195
30 Ga0070664_100023821 3300005564 Bacteria 5056
31 Ga0070664_100131730 3300005564 Bacteria 2197
32 Ga0070664_100394845 3300005564 Bacteria 1264
33 Ga0068859_100714008 3300005617 Bacteria 1093
34 Ga0068864_100186792 3300005618 Bacteria 1897
35 Ga0068860_100974924 3300005843 Bacteria 865
36 Ga0075428_100002470 3300006844 Bacteria 20063
37 Ga0075428_100047508 3300006844 Bacteria 4715
38 Ga0075428_100124517 3300006844 Bacteria 2805
39 Ga0075428_100623889 3300006844 Bacteria 1151
40 Ga0075428_100636662 3300006844 Bacteria 1138
41 Ga0075430_100082590 3300006846 Bacteria 2692
42 Ga0075430_100146022 3300006846 Unclassified 1970
43 Ga0075430_100439387 3300006846 Bacteria 1077
44 Ga0075431_100005485 3300006847 Bacteria 12529
45 Ga0075431_100868722 3300006847 Bacteria 873
46 Ga0075433_10002925 3300006852 Bacteria 13105
47 Ga0075433_10025408 3300006852 Bacteria 5007
48 Ga0075433_10046193 3300006852 Bacteria 3786
49 Ga0075433_10046348 3300006852 Bacteria 3781
50 Ga0075433_10061762 3300006852 Bacteria 3282
51 Ga0075433_10508991 3300006852 Bacteria 1059
52 Ga0075433_10800093 3300006852 Bacteria 824
53 Ga0075434_100008593 3300006871 Bacteria 9505
54 Ga0075434_100049567 3300006871 Bacteria 4170
55 Ga0075434_100274849 3300006871 Bacteria 1704
56 Ga0075434_100965173 3300006871 Unclassified 867
57 Ga0075429_100126370 3300006880 Bacteria 2236
58 Ga0097620_100714033 3300006931 Bacteria 1093
59 Ga0075435_100030179 3300007076 Bacteria 4260
60 Ga0075435_100049858 3300007076 Bacteria 3368
61 Ga0111539_10005251 3300009094 Bacteria 16780
62 Ga0111539_10014438 3300009094 Bacteria 9857
63 Ga0111539_10175079 3300009094 Bacteria 2506
64 Ga0111539_10215233 3300009094 Bacteria 2238
65 Ga0111539_10984476 3300009094 Bacteria 980
66 Ga0114129_10018139 3300009147 Bacteria 10023
67 Ga0114129_10026584 3300009147 Bacteria 8196
68 Ga0114129_10242926 3300009147 Bacteria 2420
69 Ga0114129_10328592 3300009147 Bacteria 2031
70 Ga0105241_10293011 3300009174 Bacteria 1394
71 Ga0157378_10858224 3300013297 Bacteria 936
72 Ga0157375_10707332 3300013308 Bacteria 1161
73 Ga0157375_11396675 3300013308 Bacteria 825
74 Ga0157380_10583608 3300014326 Bacteria 1103
75 Ga0157376_10225020 3300014969 Bacteria 1740
76 Ga0207653_10050168 3300025885 Bacteria 1387
77 Ga0207653_10144165 3300025885 Bacteria 873
78 Ga0207643_10123642 3300025908 Bacteria 1535
79 Ga0207684_10001171 3300025910 Bacteria 29313
80 Ga0207646_10047327 3300025922 Bacteria 3857
81 Ga0207681_10301085 3300025923 Bacteria 1269
82 Ga0207650_10041538 3300025925 Bacteria 3371
83 Ga0207650_10545355 3300025925 Bacteria 972
84 Ga0207659_10044539 3300025926 Bacteria 3122
85 Ga0207659_10084251 3300025926 Bacteria 2359
86 Ga0207644_10030620 3300025931 Bacteria 3744
87 Ga0207670_10675120 3300025936 Bacteria 854
88 Ga0207691_10072341 3300025940 Bacteria 3110
89 Ga0207679_10185710 3300025945 Bacteria 1724
90 Ga0207651_10040605 3300025960 Bacteria 3080
91 Ga0207651_10968630 3300025960 Bacteria 759
92 Ga0207668_10056127 3300025972 Bacteria 2742
93 Ga0207677_10199265 3300026023 Bacteria 1590
94 Ga0207678_10044633 3300026067 Bacteria 3833
95 Ga0207641_10250867 3300026088 Bacteria 1653
96 Ga0207676_10056473 3300026095 Bacteria 3087
97 Ga0207676_10155298 3300026095 Bacteria 1976
98 Ga0207675_100090838 3300026118 Bacteria 2871
99 Ga0207683_10181022 3300026121 Bacteria 1911
100 Ga0207428_10134281 3300027907 Bacteria 1892
101 Ga0207428_10156374 3300027907 Bacteria 1734
102 Ga0268266_10153677 3300028379 Bacteria 2077
103 Ga0265334_10035988 3300028573 Bacteria 1956
104 Ga0265339_10242788 3300031249 Bacteria 874
105 Ga0265342_10075462 3300031712 Bacteria 1956
106 Ga0307516_10394931 3300031730 Bacteria 1043
107 Ga0307413_10041948 3300031824 Bacteria 2684
108 Ga0307410_10005819 3300031852 Bacteria 6577
109 Ga0307407_10435207 3300031903 Bacteria 948
110 Ga0307409_100309514 3300031995 Bacteria 1473
111 Ga0307409_100367349 3300031995 Unclassified 1363
112 Ga0307414_10038509 3300032004 Bacteria 3212
113 Ga0373939_0189116 3300035114 Bacteria 772
114 Ga0373937_0377687 3300036401 Bacteria 1344
115 Ga0439433_0012346 3300041999 Bacteria 1873
116 Ga0439450_004842 3300042008 Bacteria 2329
117 Ga0439463_029327 3300042016 Bacteria 1386
118 Ga0439464_0003923 3300042439 Bacteria 3783
119 Ga0451577_0348613 3300042876 Bacteria 1343
120 Ga0453683_0084335 3300044673 Bacteria 1990
121 Ga0495598_0023703 3300046537 Bacteria 1656
122 Ga0495604_0100861 3300047317 Bacteria 2121
123 Ga0496106_0191368 3300048909 Bacteria 1627
124 Ga0496113_0360098 3300048916 Bacteria 1167
125 Ga0501031_0041477 3300049568 Bacteria 3005
126 Ga0501033_0093162 3300049570 Bacteria 2203
127 Ga0501036_0103197 3300049572 Bacteria 2412
128 Ga0501039_0052071 3300049575 Bacteria 3167
129 Ga0501039_0084792 3300049575 Bacteria 2468
130 Ga0501040_0002853 3300049576 Bacteria 11159
131 Ga0501041_0010445 3300049577 Bacteria 5471
132 Ga0501042_0385098 3300049578 Bacteria 1015
133 Ga0501042_0550174 3300049578 Bacteria 839
134 Ga0501046_0000849 3300049580 Bacteria 29714
135 Ga0501048_0064468 3300049582 Bacteria 2591
136 Ga0501071_0004111 3300049587 Bacteria 9200
137 Ga0501071_0118760 3300049587 Bacteria 1959
138 Ga0501074_0023674 3300049590 Bacteria 4463
139 Ga0501075_0019790 3300049591 Bacteria 4886
140 Ga0501076_0010232 3300049592 Bacteria 6953
141 Ga0501077_0018879 3300049593 Bacteria 4364
142 Ga0501249_072695 3300049679 Unclassified 804
143 Ga0501079_0000282 3300049741 Bacteria 31362
144 Ga0501080_0166123 3300049742 Bacteria 2036
145 Ga0501081_0004124 3300049743 Bacteria 9309
146 Ga0501083_0014557 3300049744 Bacteria 5499
147 Ga0501045_0000651 3300049824 Bacteria 21998
148 Ga0501045_0745854 3300049824 Bacteria 722
149 nmdc:mga0k408_298199_c1 3300050493 Bacteria 962
150 nmdc:mga05p37_177393_c1 3300050507 Bacteria 2595
151 nmdc:mga05p37_469792_c1 3300050507 Unclassified 1452
152 nmdc:mga05p37_67344_c1 3300050507 Bacteria 4405
153 nmdc:mga09592_468327_c1 3300050508 Bacteria 1086
154 nmdc:mga09592_641960_c1 3300050508 Bacteria 907
155 nmdc:mga0qj67_205450_c1 3300050509 Bacteria 1600
156 nmdc:mga06r32_20456_c1 3300050510 Bacteria 6094
157 nmdc:mga06r32_27348_c1 3300050510 Bacteria 5327
158 nmdc:mga06r32_32942_c1 3300050510 Bacteria 4879
159 nmdc:mga06r32_711667_c1 3300050510 Bacteria 969
160 nmdc:mga06r32_87146_c1 3300050510 Bacteria 3046
161 nmdc:mga08y16_117574_c1 3300050511 Bacteria 2767
162 nmdc:mga08y16_395263_c1 3300050511 Bacteria 1416
163 nmdc:mga08y16_96416_c1 3300050511 Bacteria 3080
164 nmdc:mga0n895_414534_c1 3300050512 Bacteria 1362
165 nmdc:mga0n895_7277_c1 3300050512 Bacteria 9484
166 nmdc:mga0n895_736967_c1 3300050512 Unclassified 979
167 nmdc:mga0n895_8084_c1 3300050512 Bacteria 9082
168 nmdc:mga0rr50_103338_c1 3300050513 Bacteria 2243
169 nmdc:mga0rr50_70357_c1 3300050513 Bacteria 2666
170 nmdc:mga08x19_3904_c1 3300050514 Bacteria 8869
171 nmdc:mga08x19_51896_c1 3300050514 Bacteria 2636
172 nmdc:mga0a205_4801_c1 3300050515 Bacteria 12154
173 nmdc:mga0a205_5233_c1 3300050515 Bacteria 11671
174 nmdc:mga0a205_556_c1 3300050515 Bacteria 29577
175 nmdc:mga0a205_92273_c1 3300050515 Bacteria 2926
176 Ga0501084_0001876 3300054114 Bacteria 16745
177 Ga0501082_0000742 3300060353 Bacteria 28741
178 Ga0530510_0033892 3300061734 Bacteria 3677
179 Ga0451576_0036908
180 Ga0065712_10000354
181 Ga0065712_10095727
182 Ga0065715_10004419
183 Ga0065715_10162351
184 Ga0065707_10110206
185 Ga0070670_100177708
186 Ga0070670_100261433
187 Ga0068868_100098930
188 Ga0070661_100041390
189 Ga0070668_100149100
190 Ga0070675_100047813
191 Ga0070675_100079434
192 Ga0070675_100139187
193 Ga0070671_100122971
194 Ga0070673_100009727
195 Ga0070673_100293613
196 Ga0070667_100553145
197 Ga0070703_10093971
198 Ga0070705_100226933
199 Ga0070663_100206704
200 Ga0070706_100462336
201 Ga0070707_100112581
202 Ga0070698_100174036
203 Ga0070699_100202257
204 Ga0070697_100367466
205 Ga0070695_100038593
206 Ga0070665_100209324
207 Ga0070704_100098730
208 Ga0070664_100023821
209 Ga0070664_100131730
210 Ga0070664_100394845
211 Ga0068859_100714008
212 Ga0068864_100186792
213 Ga0068860_100974924
214 Ga0075428_100002470
215 Ga0075428_100047508
216 Ga0075428_100124517
217 Ga0075428_100623889
218 Ga0075428_100636662
219 Ga0075430_100082590
220 Ga0075430_100146022
221 Ga0075430_100439387
222 Ga0075431_100005485
223 Ga0075431_100868722
224 Ga0075433_10002925
225 Ga0075433_10025408
226 Ga0075433_10046193
227 Ga0075433_10046348
228 Ga0075433_10061762
229 Ga0075433_10508991
230 Ga0075433_10800093
231 Ga0075434_100008593
232 Ga0075434_100049567
233 Ga0075434_100274849
234 Ga0075434_100965173
235 Ga0075429_100126370
236 Ga0097620_100714033
237 Ga0075435_100030179
238 Ga0075435_100049858
239 Ga0111539_10005251
240 Ga0111539_10014438
241 Ga0111539_10175079
242 Ga0111539_10215233
243 Ga0111539_10984476
244 Ga0114129_10018139
245 Ga0114129_10026584
246 Ga0114129_10242926
247 Ga0114129_10328592
248 Ga0105241_10293011
249 Ga0157378_10858224
250 Ga0157375_10707332
251 Ga0157375_11396675
252 Ga0157380_10583608
253 Ga0157376_10225020
254 Ga0207653_10050168
255 Ga0207653_10144165
256 Ga0207643_10123642
257 Ga0207684_10001171
258 Ga0207646_10047327
259 Ga0207681_10301085
260 Ga0207650_10041538
261 Ga0207650_10545355
262 Ga0207659_10044539
263 Ga0207659_10084251
264 Ga0207644_10030620
265 Ga0207670_10675120
266 Ga0207691_10072341
267 Ga0207679_10185710
268 Ga0207651_10040605
269 Ga0207651_10968630
270 Ga0207668_10056127
271 Ga0207677_10199265
272 Ga0207678_10044633
273 Ga0207641_10250867
274 Ga0207676_10056473
275 Ga0207676_10155298
276 Ga0207675_100090838
277 Ga0207683_10181022
278 Ga0207428_10134281
279 Ga0207428_10156374
280 Ga0268266_10153677
281 Ga0265334_10035988
282 Ga0265339_10242788
283 Ga0265342_10075462
284 Ga0307516_10394931
285 Ga0307413_10041948
286 Ga0307410_10005819
287 Ga0307407_10435207
288 Ga0307409_100309514
289 Ga0307409_100367349
290 Ga0307414_10038509
291 Ga0373939_0189116
292 Ga0373937_0377687
293 Ga0439433_0012346
294 Ga0439450_004842
295 Ga0439463_029327
296 Ga0439464_0003923
297 Ga0451577_0348613
298 Ga0453683_0084335
299 Ga0495598_0023703
300 Ga0495604_0100861
301 Ga0496106_0191368
302 Ga0496113_0360098
303 Ga0501031_0041477
304 Ga0501033_0093162
305 Ga0501036_0103197
306 Ga0501039_0052071
307 Ga0501039_0084792
308 Ga0501040_0002853
309 Ga0501041_0010445
310 Ga0501042_0385098
311 Ga0501042_0550174
312 Ga0501046_0000849
313 Ga0501048_0064468
314 Ga0501071_0004111
315 Ga0501071_0118760
316 Ga0501074_0023674
317 Ga0501075_0019790
318 Ga0501076_0010232
319 Ga0501077_0018879
320 Ga0501249_072695
321 Ga0501079_0000282
322 Ga0501080_0166123
323 Ga0501081_0004124
324 Ga0501083_0014557
325 Ga0501045_0000651
326 Ga0501045_0745854
327 nmdc:mga0k408_298199_c1
328 nmdc:mga05p37_177393_c1
329 nmdc:mga05p37_469792_c1
330 nmdc:mga05p37_67344_c1
331 nmdc:mga09592_468327_c1
332 nmdc:mga09592_641960_c1
333 nmdc:mga0qj67_205450_c1
334 nmdc:mga06r32_20456_c1
335 nmdc:mga06r32_27348_c1
336 nmdc:mga06r32_32942_c1
337 nmdc:mga06r32_711667_c1
338 nmdc:mga06r32_87146_c1
339 nmdc:mga08y16_117574_c1
340 nmdc:mga08y16_395263_c1
341 nmdc:mga08y16_96416_c1
342 nmdc:mga0n895_414534_c1
343 nmdc:mga0n895_7277_c1
344 nmdc:mga0n895_736967_c1
345 nmdc:mga0n895_8084_c1
346 nmdc:mga0rr50_103338_c1
347 nmdc:mga0rr50_70357_c1
348 nmdc:mga08x19_3904_c1
349 nmdc:mga08x19_51896_c1
350 nmdc:mga0a205_4801_c1
351 nmdc:mga0a205_5233_c1
352 nmdc:mga0a205_556_c1
353 nmdc:mga0a205_92273_c1
354 Ga0501084_0001876
355 Ga0501082_0000742
356 Ga0530510_0033892

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22677

Ble-like_N

Bleomycin resistance protein-like N-terminal

34

64

0.89

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

31

163

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.839 18 157
5ujp-assembly1.cif.gz_B the crystal structure of a glyoxalase/bleomycin resistance protein from streptomyces sp. cb03234 0.8237 25 156
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.8199 18 157
5umq-assembly1.cif.gz_A crystal structure of tnms1, an antibiotic binding protein from streptomyces sp. cb03234 0.8156 19 156
4hc5-assembly2.cif.gz_C crystal structure of member of glyoxalase/bleomycin resistance protein/dioxygenase superfamily from sphaerobacter thermophilus dsm 20745 0.8121 20 156
ID Description Score Start End Superfamily
5ujpB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8227 25 156 3.10.180.10
4hc5C00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8113 22 156 3.10.180.10
5ujpB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7961 25 156 3.10.180.10
4hc5C00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7813 22 156 3.10.180.10
3ghjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7628 20 157 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A521LQ03-F1-model_v4 Glyoxalase 0.9541 17 102
AF-A0A7W8C6X0-F1-model_v4 Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9472 19 157 GO:0016829
GO:0051213
AF-A0A4R2J329-F1-model_v4 Putative lactoylglutathione lyase 0.9443 19 155 GO:0016829
AF-A0A2N3VCF3-F1-model_v4 Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9428 16 157 GO:0016829
GO:0051213
AF-A0A0Q6GLT3-F1-model_v4 Glyoxalase 0.9408 17 157

Map