F272357

General Info

Members Datasets Scaffolds Average Seq Length
178 146 356 278

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0125445|Ga0395899_0125445_806_1711
Length 301
Sequence LNASARRFKARCCSVAVGRIEGYIMQNVTLPSGETVPALGQGTWNIGDRQDRRAEEIAALRAGLDLGMTLIDTAEMYGDGNSEELVGEAIAGRRDEVFLVSKVLPSNASRRGTIAACERSLARLQTDRIDLYLLHWRGNVSLKDTLHAFEALQRDGKIRHWGVSNFDVDDMEELTALAGGNAVAANQVLYNLTRRGIEYDLLPWSAAHRIPTMAYSPIEQGRLLRQAALRQVAARHGASPAQVALAWLLRRADVIAIPKAGSVKHVQENAAALEIRLTAEDLAELDRAWPPPKSKRSLEMI

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
51 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
54 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
55 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
79 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
80 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
81 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
82 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
83 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
84 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
85 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
86 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
89 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
97 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
98 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
99 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
102 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
103 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
104 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
105 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
106 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
107 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
108 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
109 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
110 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
111 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
112 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
113 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
114 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
115 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
126 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
127 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
128 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
129 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
130 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
131 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
132 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
133 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
134 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
135 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
136 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
137 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
138 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
139 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
140 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
141 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
143 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
144 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
145 2854911287 Brucella lupini LUP21 Isolate Unclassified
146 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.19
Metatranscriptomes 0.56
Isolates 2.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.43
Nodule 1.12
Rhizoplane 0
Rhizosphere 74.72
Stem 0
Stem Tuber 0
Unclassified 2.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0125445 3300037312 Bacteria 1836
2 MBSR1b_contig_8046877 2162886012 Bacteria 1495
3 JGI25165J46597_1003220 3300003214 Bacteria 4274
4 rootH2_10002138 3300003320 Bacteria 7415
5 rootH1_10136924 3300003323 Bacteria 1971
6 Ga0006562J51391_1008502 3300003578 Bacteria 3320
7 Ga0070658_10004305 3300005327 Bacteria 11635
8 Ga0070660_100027654 3300005339 Bacteria 4234
9 Ga0070661_100027689 3300005344 Bacteria 4083
10 Ga0070661_100055423 3300005344 Bacteria 2903
11 Ga0070675_100443398 3300005354 Bacteria 1163
12 Ga0070659_100033093 3300005366 Bacteria 4014
13 Ga0070705_100212236 3300005440 Bacteria 1335
14 Ga0070694_100067932 3300005444 Bacteria 2448
15 Ga0070663_100173260 3300005455 Bacteria 1669
16 Ga0070707_100018973 3300005468 Bacteria 6478
17 Ga0070686_100451968 3300005544 Bacteria 988
18 Ga0070665_100019976 3300005548 Bacteria 6727
19 Ga0070665_100074549 3300005548 Bacteria 3399
20 Ga0070704_100029285 3300005549 Bacteria 3674
21 Ga0068855_100041540 3300005563 Bacteria 5450
22 Ga0070664_100333086 3300005564 Bacteria 1377
23 Ga0068857_100191855 3300005577 Bacteria 1861
24 Ga0068854_100027377 3300005578 Bacteria 3929
25 Ga0068856_100053262 3300005614 Bacteria 3989
26 Ga0068856_100091598 3300005614 Bacteria 3024
27 Ga0068856_100298520 3300005614 Bacteria 1628
28 Ga0068852_100020685 3300005616 Bacteria 5235
29 Ga0068852_100036990 3300005616 Bacteria 4090
30 Ga0068859_100116027 3300005617 Bacteria 2742
31 Ga0068859_100117381 3300005617 Unclassified 2726
32 Ga0068864_100162175 3300005618 Unclassified 2033
33 Ga0068863_100000683 3300005841 Bacteria 34221
34 Ga0068860_100000439 3300005843 Bacteria 52876
35 Ga0068862_100005996 3300005844 Bacteria 10118
36 Ga0075364_10057574 3300006051 Bacteria 2546
37 Ga0075362_10004178 3300006177 Bacteria 5151
38 Ga0075367_10006120 3300006178 Bacteria 6050
39 Ga0075366_10019809 3300006195 Bacteria 3899
40 Ga0075370_10075786 3300006353 Bacteria 1929
41 Ga0075428_100534126 3300006844 Bacteria 1254
42 Ga0075430_100363948 3300006846 Bacteria 1194
43 Ga0097620_100116031 3300006931 Bacteria 2742
44 Ga0097620_100117377 3300006931 Unclassified 2726
45 Ga0105240_10123167 3300009093 Bacteria 3120
46 Ga0105247_10050115 3300009101 Bacteria 2569
47 Ga0105237_10000067 3300009545 Bacteria 139093
48 Ga0105237_10018959 3300009545 Bacteria 7109
49 Ga0105238_10063194 3300009551 Bacteria 3702
50 Ga0105239_10001775 3300010375 Bacteria 28359
51 Ga0105239_10011267 3300010375 Bacteria 9974
52 Ga0105239_10078706 3300010375 Bacteria 3628
53 Ga0105239_10306353 3300010375 Bacteria 1789
54 Ga0157371_10004093 3300013102 Bacteria 12889
55 Ga0157369_10070524 3300013105 Bacteria 3754
56 Ga0157378_10074499 3300013297 Bacteria 3055
57 Ga0157378_11036672 3300013297 Bacteria 856
58 Ga0163162_10099491 3300013306 Bacteria 2999
59 Ga0157372_10064520 3300013307 Bacteria 4109
60 Ga0157375_10074637 3300013308 Bacteria 3413
61 Ga0157377_10124589 3300014745 Unclassified 1566
62 Ga0213872_10101789 3300021361 Bacteria 1280
63 Ga0213874_10021787 3300021377 Bacteria 1771
64 Ga0213876_10015776 3300021384 Bacteria 3998
65 Ga0213876_10031143 3300021384 Bacteria 2815
66 Ga0213875_10020456 3300021388 Bacteria 3175
67 Ga0213875_10096887 3300021388 Bacteria 1376
68 Ga0209233_1000838 3300025261 Bacteria 13595
69 Ga0209675_1006456 3300025291 Bacteria 4693
70 Ga0207688_10282911 3300025901 Bacteria 1011
71 Ga0207647_10038788 3300025904 Bacteria 3010
72 Ga0207645_10176274 3300025907 Bacteria 1402
73 Ga0207695_10129258 3300025913 Bacteria 2485
74 Ga0207671_10000184 3300025914 Bacteria 95741
75 Ga0207657_10024988 3300025919 Bacteria 5519
76 Ga0207649_10334898 3300025920 Bacteria 1116
77 Ga0207646_10144878 3300025922 Bacteria 2140
78 Ga0207694_10048309 3300025924 Bacteria 3293
79 Ga0207667_10003128 3300025949 Bacteria 20492
80 Ga0207667_10131612 3300025949 Bacteria 2577
81 Ga0207640_10205991 3300025981 Bacteria 1494
82 Ga0207658_10010786 3300025986 Bacteria 6217
83 Ga0207703_10000879 3300026035 Bacteria 29518
84 Ga0207639_10006615 3300026041 Bacteria 7882
85 Ga0207678_10014732 3300026067 Bacteria 6880
86 Ga0207678_10033442 3300026067 Bacteria 4479
87 Ga0207678_10278396 3300026067 Bacteria 1435
88 Ga0207702_10120517 3300026078 Bacteria 2347
89 Ga0207641_10000900 3300026088 Bacteria 30838
90 Ga0207676_10384309 3300026095 Bacteria 1308
91 Ga0209813_10026004 3300027866 Bacteria 1689
92 Ga0268266_10000219 3300028379 Bacteria 99898
93 Ga0268266_10002131 3300028379 Bacteria 21831
94 Ga0268266_10270287 3300028379 Bacteria 1578
95 Ga0268265_10004117 3300028380 Bacteria 10216
96 Ga0268264_10000100 3300028381 Bacteria 227852
97 Ga0268264_10053510 3300028381 Bacteria 3368
98 Ga0265334_10070159 3300028573 Bacteria 1307
99 Ga0265330_10039878 3300031235 Bacteria 2085
100 Ga0265325_10047041 3300031241 Bacteria 2234
101 Ga0265329_10012573 3300031242 Bacteria 3039
102 Ga0265339_10001526 3300031249 Bacteria 17093
103 Ga0265316_10168311 3300031344 Bacteria 1636
104 Ga0265313_10001705 3300031595 Bacteria 20248
105 Ga0307508_10094733 3300031616 Bacteria 2576
106 Ga0265342_10033353 3300031712 Bacteria 3166
107 Ga0307412_10173110 3300031911 Bacteria 1616
108 Ga0373946_0106568 3300035171 Bacteria 1263
109 Ga0373947_0069684 3300035725 Bacteria 2153
110 Ga0395899_0000866 3300037312 Bacteria 28838
111 Ga0395899_0015757 3300037312 Bacteria 5763
112 Ga0395900_0090517 3300037418 Bacteria 3145
113 Ga0395900_0117849 3300037418 Bacteria 2724
114 Ga0395898_0331716 3300037466 Bacteria 1450
115 Ga0395905_0007101 3300037471 Bacteria 11192
116 Ga0395905_0022590 3300037471 Bacteria 5949
117 Ga0395905_0215933 3300037471 Bacteria 1796
118 Ga0395905_0280042 3300037471 Bacteria 1554
119 Ga0436364_0040345 3300037853 Bacteria 7562
120 Ga0395901_0244583 3300038443 Bacteria 1870
121 Ga0436365_0151275 3300039437 Bacteria 2885
122 Ga0436365_0994234 3300039437 Bacteria 49963
123 Ga0436361_0598160 3300039447 Bacteria 2113
124 Ga0436363_0105457 3300039450 Bacteria 4178
125 Ga0436363_0500344 3300039450 Bacteria 5265
126 Ga0436363_0665385 3300039450 Bacteria 1474
127 Ga0436362_0691627 3300039453 Bacteria 3021
128 Ga0466961_0071726 3300044693 Bacteria 2197
129 Ga0466967_0194192 3300045976 Bacteria 1920
130 Ga0495648_0001091 3300046524 Bacteria 27599
131 Ga0495642_0153121 3300046528 Bacteria 998
132 Ga0495665_0018724 3300046531 Bacteria 3720
133 Ga0495672_0012817 3300047320 Bacteria 5824
134 Ga0495687_003486 3300047443 Bacteria 11354
135 Ga0496116_0005858 3300048919 Bacteria 11292
136 Ga0496117_0000035 3300048920 Bacteria 326449
137 Ga0496118_0000038 3300048921 Bacteria 315464
138 Ga0496119_0020435 3300048922 Bacteria 4833
139 Ga0496119_0025343 3300048922 Bacteria 4145
140 Ga0496120_0023712 3300048923 Bacteria 3837
141 Ga0496120_0138696 3300048923 Bacteria 1237
142 Ga0496121_0040008 3300048924 Bacteria 4120
143 Ga0496124_0037692 3300048927 Bacteria 4202
144 Ga0496125_0001172 3300048928 Bacteria 39694
145 Ga0496125_0010167 3300048928 Bacteria 9536
146 Ga0496126_0095059 3300048929 Bacteria 2614
147 Ga0501031_0039678 3300049568 Bacteria 3073
148 Ga0501034_0118084 3300049571 Bacteria 2640
149 Ga0501036_0023429 3300049572 Bacteria 5202
150 Ga0501038_0002021 3300049574 Bacteria 18733
151 Ga0501040_0039628 3300049576 Bacteria 3204
152 Ga0501041_0016698 3300049577 Bacteria 4369
153 Ga0501042_0028383 3300049578 Bacteria 3941
154 Ga0501046_0068481 3300049580 Bacteria 2763
155 Ga0501047_0205489 3300049581 Bacteria 1829
156 Ga0501048_0179097 3300049582 Bacteria 1502
157 Ga0501068_0173590 3300049584 Bacteria 1361
158 Ga0501071_0054464 3300049587 Bacteria 2886
159 Ga0501072_0070975 3300049588 Bacteria 2751
160 Ga0501073_0106183 3300049589 Bacteria 1949
161 Ga0501074_0108733 3300049590 Bacteria 1984
162 Ga0501075_0174073 3300049591 Bacteria 1643
163 Ga0501238_004660 3300049671 Bacteria 1720
164 Ga0501081_0156776 3300049743 Bacteria 1638
165 Ga0501045_0130298 3300049824 Bacteria 1869
166 nmdc:mga03683_28866_c1 3300050489 Bacteria 2209
167 nmdc:mga0yw44_57029_c1 3300050492 Bacteria 2382
168 nmdc:mga0k408_43741_c1 3300050493 Bacteria 2582
169 nmdc:mga04h51_20857_c1 3300050495 Bacteria 1963
170 nmdc:mga07m45_103036_c1 3300050496 Bacteria 1640
171 nmdc:mga05p37_436220_c1 3300050507 Bacteria 1520
172 Ga0500593_000607 3300053117 Bacteria 13785
173 Ga0501084_0070105 3300054114 Bacteria 2935
174 Ga0501082_0031217 3300060353 Bacteria 4593
175 2513591799 2513237087 Bacteria 5817514
176 2835312793 2835312727 Bacteria 7413381
177 2854912128 2854911287 Bacteria 5582813
178 2966924677 2966924647 Bacteria 3268643
179 Ga0395899_0125445
180 MBSR1b_contig_8046877
181 JGI25165J46597_1003220
182 rootH2_10002138
183 rootH1_10136924
184 Ga0006562J51391_1008502
185 Ga0070658_10004305
186 Ga0070660_100027654
187 Ga0070661_100027689
188 Ga0070661_100055423
189 Ga0070675_100443398
190 Ga0070659_100033093
191 Ga0070705_100212236
192 Ga0070694_100067932
193 Ga0070663_100173260
194 Ga0070707_100018973
195 Ga0070686_100451968
196 Ga0070665_100019976
197 Ga0070665_100074549
198 Ga0070704_100029285
199 Ga0068855_100041540
200 Ga0070664_100333086
201 Ga0068857_100191855
202 Ga0068854_100027377
203 Ga0068856_100053262
204 Ga0068856_100091598
205 Ga0068856_100298520
206 Ga0068852_100020685
207 Ga0068852_100036990
208 Ga0068859_100116027
209 Ga0068859_100117381
210 Ga0068864_100162175
211 Ga0068863_100000683
212 Ga0068860_100000439
213 Ga0068862_100005996
214 Ga0075364_10057574
215 Ga0075362_10004178
216 Ga0075367_10006120
217 Ga0075366_10019809
218 Ga0075370_10075786
219 Ga0075428_100534126
220 Ga0075430_100363948
221 Ga0097620_100116031
222 Ga0097620_100117377
223 Ga0105240_10123167
224 Ga0105247_10050115
225 Ga0105237_10000067
226 Ga0105237_10018959
227 Ga0105238_10063194
228 Ga0105239_10001775
229 Ga0105239_10011267
230 Ga0105239_10078706
231 Ga0105239_10306353
232 Ga0157371_10004093
233 Ga0157369_10070524
234 Ga0157378_10074499
235 Ga0157378_11036672
236 Ga0163162_10099491
237 Ga0157372_10064520
238 Ga0157375_10074637
239 Ga0157377_10124589
240 Ga0213872_10101789
241 Ga0213874_10021787
242 Ga0213876_10015776
243 Ga0213876_10031143
244 Ga0213875_10020456
245 Ga0213875_10096887
246 Ga0209233_1000838
247 Ga0209675_1006456
248 Ga0207688_10282911
249 Ga0207647_10038788
250 Ga0207645_10176274
251 Ga0207695_10129258
252 Ga0207671_10000184
253 Ga0207657_10024988
254 Ga0207649_10334898
255 Ga0207646_10144878
256 Ga0207694_10048309
257 Ga0207667_10003128
258 Ga0207667_10131612
259 Ga0207640_10205991
260 Ga0207658_10010786
261 Ga0207703_10000879
262 Ga0207639_10006615
263 Ga0207678_10014732
264 Ga0207678_10033442
265 Ga0207678_10278396
266 Ga0207702_10120517
267 Ga0207641_10000900
268 Ga0207676_10384309
269 Ga0209813_10026004
270 Ga0268266_10000219
271 Ga0268266_10002131
272 Ga0268266_10270287
273 Ga0268265_10004117
274 Ga0268264_10000100
275 Ga0268264_10053510
276 Ga0265334_10070159
277 Ga0265330_10039878
278 Ga0265325_10047041
279 Ga0265329_10012573
280 Ga0265339_10001526
281 Ga0265316_10168311
282 Ga0265313_10001705
283 Ga0307508_10094733
284 Ga0265342_10033353
285 Ga0307412_10173110
286 Ga0373946_0106568
287 Ga0373947_0069684
288 Ga0395899_0000866
289 Ga0395899_0015757
290 Ga0395900_0090517
291 Ga0395900_0117849
292 Ga0395898_0331716
293 Ga0395905_0007101
294 Ga0395905_0022590
295 Ga0395905_0215933
296 Ga0395905_0280042
297 Ga0436364_0040345
298 Ga0395901_0244583
299 Ga0436365_0151275
300 Ga0436365_0994234
301 Ga0436361_0598160
302 Ga0436363_0105457
303 Ga0436363_0500344
304 Ga0436363_0665385
305 Ga0436362_0691627
306 Ga0466961_0071726
307 Ga0466967_0194192
308 Ga0495648_0001091
309 Ga0495642_0153121
310 Ga0495665_0018724
311 Ga0495672_0012817
312 Ga0495687_003486
313 Ga0496116_0005858
314 Ga0496117_0000035
315 Ga0496118_0000038
316 Ga0496119_0020435
317 Ga0496119_0025343
318 Ga0496120_0023712
319 Ga0496120_0138696
320 Ga0496121_0040008
321 Ga0496124_0037692
322 Ga0496125_0001172
323 Ga0496125_0010167
324 Ga0496126_0095059
325 Ga0501031_0039678
326 Ga0501034_0118084
327 Ga0501036_0023429
328 Ga0501038_0002021
329 Ga0501040_0039628
330 Ga0501041_0016698
331 Ga0501042_0028383
332 Ga0501046_0068481
333 Ga0501047_0205489
334 Ga0501048_0179097
335 Ga0501068_0173590
336 Ga0501071_0054464
337 Ga0501072_0070975
338 Ga0501073_0106183
339 Ga0501074_0108733
340 Ga0501075_0174073
341 Ga0501238_004660
342 Ga0501081_0156776
343 Ga0501045_0130298
344 nmdc:mga03683_28866_c1
345 nmdc:mga0yw44_57029_c1
346 nmdc:mga0k408_43741_c1
347 nmdc:mga04h51_20857_c1
348 nmdc:mga07m45_103036_c1
349 nmdc:mga05p37_436220_c1
350 Ga0500593_000607
351 Ga0501084_0070105
352 Ga0501082_0031217
353 2513591799
354 2835312793
355 2854912128
356 2966924677

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

38

290

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xap-assembly1.cif.gz_A crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 0.9882 1 277
4xap-assembly1.cif.gz_A crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 0.9847 1 277
4wgh-assembly1.cif.gz_A crystal structure of aldo/keto reductase from klebsiella pneumoniae in complex with nadp and acetate at 1.8 a resolution 0.97 1 277
6cia-assembly1.cif.gz_A crystal structure of aldo-keto reductase from klebsiella pneumoniae in complex with nadph. 0.9677 1 277
4wgh-assembly1.cif.gz_A crystal structure of aldo/keto reductase from klebsiella pneumoniae in complex with nadp and acetate at 1.8 a resolution 0.9666 1 277
ID Description Score Start End Superfamily
4xapA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9882 1 277 3.20.20.100
4xapA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9847 1 277 3.20.20.100
5danA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.931 1 263 3.20.20.100
af_Q7XCS4_50_365_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.916 10 266 3.20.20.100
af_C4J2K0_1_323_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9137 1 270 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A529LBW9-F1-model_v4 Aldo/keto reductase 1.002 84 167 GO:0016491
AF-A0A2V5KD58-F1-model_v4 Oxidoreductase 0.995 108 277
AF-A0A436WCT6-F1-model_v4 Aldo/keto reductase 0.9919 164 277
AF-A0A7H8HY50-F1-model_v4 Aldo/keto reductase 0.9913 2 277 GO:0016491
AF-A0A1J7CA35-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9908 108 277 GO:0016491

Map