F272243

General Info

Members Datasets Scaffolds Average Seq Length
178 72 177 136

Family's Representative Sequence

Representative Sequence 3300031238|Ga0265332_10040591|Ga0265332_100405913
Length 149
Sequence VDGRRAPGGLTMLGRNYTQRHYEGVHIDMTPMVDCVLVLLIFLMISSAFVQDPGIEVEKPDVGGTQLNGSQNTLLIAIAADNRIFFDGQEVPIDQAAGRIKQAAVGADPTLVIRADRACSHGTFAAVFAAAKRAGVSRVTFATAQTGAQ

Samples

Sample ID Description Type Environment
1 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
19 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
20 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
21 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
22 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
23 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
34 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
35 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
36 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
37 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
38 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
39 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
40 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
41 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
42 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
43 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
44 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
45 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
46 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
47 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
48 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
49 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
50 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
51 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
52 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
53 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
54 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
55 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
56 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
57 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
58 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
59 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
60 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
61 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
62 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
63 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
64 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
65 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
66 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
67 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
68 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
69 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
70 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
71 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
72 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0
Isolates 0.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 0
Rhizosphere 94.38
Stem 0
Stem Tuber 0
Unclassified 5.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10000634 3300003320 Bacteria 7676
2 rootH2_10010124 3300003320 Bacteria 68506
3 rootL2_10059516 3300003322 Bacteria 8432
4 rootL2_10075442 3300003322 Bacteria 18471
5 rootL2_10099330 3300003322 Bacteria 7680
6 rootH1_10197980 3300003323 Bacteria 5566
7 rootH1_10228559 3300003323 Bacteria 5495
8 Ga0070658_10063238 3300005327 Bacteria 3017
9 Ga0070658_10546533 3300005327 Unclassified 1002
10 Ga0070683_100027294 3300005329 Bacteria 5148
11 Ga0070683_100166370 3300005329 Bacteria 2092
12 Ga0070683_100814642 3300005329 Bacteria 895
13 Ga0068869_100544780 3300005334 Bacteria 974
14 Ga0070680_100461361 3300005336 Unclassified 1085
15 Ga0070707_102300847 3300005468 Unclassified 506
16 Ga0070679_100006625 3300005530 Bacteria 10799
17 Ga0070679_100019648 3300005530 Bacteria 6574
18 Ga0070684_100235061 3300005535 Bacteria 1674
19 Ga0068853_101864484 3300005539 Bacteria 583
20 Ga0068855_102230936 3300005563 Unclassified 549
21 Ga0068857_100026903 3300005577 Bacteria 5072
22 Ga0068856_100000470 3300005614 Bacteria 44487
23 Ga0068856_100384282 3300005614 Bacteria 1423
24 Ga0068856_100598128 3300005614 Bacteria 1124
25 Ga0068860_100695388 3300005843 Unclassified 1026
26 Ga0070717_10000653 3300006028 Bacteria 22254
27 Ga0105239_11959140 3300010375 Bacteria 680
28 Ga0157369_10123589 3300013105 Bacteria 2745
29 Ga0157374_10774914 3300013296 Unclassified 974
30 Ga0163163_10037465 3300014325 Bacteria 4717
31 Ga0163163_10044108 3300014325 Bacteria 4374
32 Ga0157376_10814605 3300014969 Bacteria 947
33 Ga0207705_10276970 3300025909 Bacteria 1284
34 Ga0207705_10412631 3300025909 Unclassified 1045
35 Ga0207660_10814588 3300025917 Unclassified 762
36 Ga0207652_10009610 3300025921 Bacteria 7780
37 Ga0207661_10002709 3300025944 Bacteria 12194
38 Ga0207661_10002961 3300025944 Bacteria 11747
39 Ga0207661_10488035 3300025944 Bacteria 1125
40 Ga0207667_11394566 3300025949 Unclassified 674
41 Ga0207677_11839430 3300026023 Bacteria 562
42 Ga0207702_10000364 3300026078 Bacteria 51844
43 Ga0207702_10285031 3300026078 Bacteria 1563
44 Ga0207702_10749533 3300026078 Bacteria 964
45 Ga0207641_10710034 3300026088 Bacteria 991
46 Ga0207674_10081465 3300026116 Unclassified 3239
47 Ga0207674_11075427 3300026116 Bacteria 774
48 Ga0268264_10976945 3300028381 Unclassified 853
49 Ga0265337_1000413 3300028556 Bacteria 22825
50 Ga0265337_1006020 3300028556 Bacteria 4729
51 Ga0265337_1009540 3300028556 Bacteria 3458
52 Ga0265326_10085259 3300028558 Bacteria 894
53 Ga0265319_1000031 3300028563 Bacteria 124456
54 Ga0265319_1000601 3300028563 Bacteria 24020
55 Ga0265319_1002735 3300028563 Bacteria 9471
56 Ga0265319_1004019 3300028563 Bacteria 7449
57 Ga0265319_1014142 3300028563 Bacteria 3140
58 Ga0265319_1026978 3300028563 Bacteria 2041
59 Ga0265334_10008255 3300028573 Bacteria 4433
60 Ga0265318_10000999 3300028577 Bacteria 18122
61 Ga0265318_10001180 3300028577 Bacteria 16148
62 Ga0265318_10002767 3300028577 Bacteria 9186
63 Ga0265318_10020686 3300028577 Bacteria 2652
64 Ga0265323_10005731 3300028653 Bacteria 5263
65 Ga0265323_10008446 3300028653 Bacteria 4245
66 Ga0265323_10014044 3300028653 Bacteria 3181
67 Ga0265323_10042121 3300028653 Bacteria 1655
68 Ga0265323_10044157 3300028653 Bacteria 1606
69 Ga0265323_10251029 3300028653 Unclassified 550
70 Ga0265322_10002859 3300028654 Bacteria 5272
71 Ga0265322_10017059 3300028654 Bacteria 2093
72 Ga0265322_10176019 3300028654 Bacteria 612
73 Ga0265336_10000828 3300028666 Bacteria 16184
74 Ga0265336_10030821 3300028666 Unclassified 1669
75 Ga0265336_10146873 3300028666 Bacteria 701
76 Ga0307515_10257731 3300028794 Bacteria 1486
77 Ga0265338_10003810 3300028800 Bacteria 20958
78 Ga0265338_10008277 3300028800 Bacteria 12656
79 Ga0265338_10094353 3300028800 Bacteria 2462
80 Ga0265338_10791257 3300028800 Bacteria 650
81 Ga0265324_10001218 3300029957 Bacteria 15248
82 Ga0265324_10001912 3300029957 Bacteria 11180
83 Ga0265324_10292124 3300029957 Unclassified 554
84 Ga0265330_10025056 3300031235 Bacteria 2705
85 Ga0265330_10047911 3300031235 Bacteria 1880
86 Ga0265330_10345416 3300031235 Bacteria 628
87 Ga0265332_10037402 3300031238 Bacteria 2105
88 Ga0265332_10040591 3300031238 Bacteria 2014
89 Ga0265332_10229871 3300031238 Bacteria 769
90 Ga0265332_10283595 3300031238 Bacteria 684
91 Ga0265332_10422925 3300031238 Unclassified 550
92 Ga0265328_10026773 3300031239 Bacteria 2166
93 Ga0265328_10097098 3300031239 Bacteria 1090
94 Ga0265320_10000674 3300031240 Bacteria 26001
95 Ga0265320_10000682 3300031240 Bacteria 25880
96 Ga0265320_10002673 3300031240 Bacteria 12329
97 Ga0265320_10033279 3300031240 Bacteria 2632
98 Ga0265320_10038680 3300031240 Bacteria 2391
99 Ga0265320_10079357 3300031240 Bacteria 1534
100 Ga0265320_10112441 3300031240 Unclassified 1246
101 Ga0265325_10011948 3300031241 Bacteria 4976
102 Ga0265325_10052557 3300031241 Bacteria 2091
103 Ga0265325_10055616 3300031241 Bacteria 2023
104 Ga0265329_10162849 3300031242 Bacteria 726
105 Ga0265340_10116185 3300031247 Unclassified 1233
106 Ga0265340_10172900 3300031247 Bacteria 978
107 Ga0265339_10029815 3300031249 Bacteria 3093
108 Ga0265331_10126973 3300031250 Unclassified 1165
109 Ga0265331_10127195 3300031250 Bacteria 1164
110 Ga0265327_10000047 3300031251 Bacteria 273466
111 Ga0265327_10002716 3300031251 Bacteria 18109
112 Ga0265327_10003411 3300031251 Bacteria 15218
113 Ga0265327_10161896 3300031251 Bacteria 1033
114 Ga0265316_10002850 3300031344 Bacteria 17689
115 Ga0265316_10049477 3300031344 Bacteria 3311
116 Ga0265316_10344511 3300031344 Unclassified 1080
117 Ga0265313_10000936 3300031595 Bacteria 29074
118 Ga0265313_10009975 3300031595 Bacteria 6088
119 Ga0265313_10012793 3300031595 Bacteria 5093
120 Ga0265313_10048892 3300031595 Bacteria 2038
121 Ga0265313_10070924 3300031595 Bacteria 1604
122 Ga0265313_10227796 3300031595 Unclassified 767
123 Ga0265314_10000902 3300031711 Bacteria 35158
124 Ga0265314_10001941 3300031711 Bacteria 22063
125 Ga0265314_10035322 3300031711 Bacteria 3644
126 Ga0265314_10094414 3300031711 Unclassified 1939
127 Ga0265314_10107002 3300031711 Bacteria 1785
128 Ga0265314_10343435 3300031711 Bacteria 823
129 Ga0265314_10359057 3300031711 Unclassified 799
130 Ga0265314_10365591 3300031711 Unclassified 789
131 Ga0265342_10028211 3300031712 Bacteria 3500
132 Ga0265342_10157701 3300031712 Bacteria 1256
133 Ga0265342_10210920 3300031712 Bacteria 1050
134 Ga0265342_10446257 3300031712 Unclassified 664
135 Ga0307413_10721860 3300031824 Bacteria 830
136 Ga0307414_10594898 3300032004 Bacteria 991
137 Ga0307414_11158347 3300032004 Bacteria 715
138 Ga0439445_0010894 3300042004 Bacteria 2159
139 Ga0451577_0068049 3300042876 Bacteria 3176
140 Ga0451577_0115566 3300042876 Unclassified 2403
141 Ga0451577_0302098 3300042876 Bacteria 1450
142 Ga0451577_0611457 3300042876 Bacteria 989
143 Ga0466969_0413543 3300044656 Bacteria 612
144 Ga0453683_0000149 3300044673 Bacteria 102898
145 Ga0453683_0001319 3300044673 Bacteria 21827
146 Ga0453683_0022062 3300044673 Bacteria 4062
147 Ga0453683_0084036 3300044673 Bacteria 1995
148 Ga0453683_0362691 3300044673 Bacteria 931
149 Ga0453684_0000019 3300044712 Bacteria 908702
150 Ga0453684_0004529 3300044712 Bacteria 29160
151 Ga0453684_0013967 3300044712 Bacteria 12940
152 Ga0453684_0033619 3300044712 Bacteria 7144
153 Ga0453684_0063331 3300044712 Bacteria 4731
154 Ga0453684_0111589 3300044712 Unclassified 3321
155 Ga0453684_0189458 3300044712 Bacteria 2407
156 Ga0453684_0312525 3300044712 Bacteria 1782
157 Ga0453684_1415919 3300044712 Unclassified 720
158 Ga0453684_1533802 3300044712 Bacteria 686
159 Ga0466968_0091044 3300044735 Unclassified 1351
160 Ga0451576_0000251 3300045051 Bacteria 132099
161 Ga0451576_0000548 3300045051 Bacteria 80649
162 Ga0451576_0000586 3300045051 Bacteria 77149
163 Ga0451576_0003259 3300045051 Bacteria 22524
164 Ga0451576_0003534 3300045051 Bacteria 21319
165 Ga0451576_0013591 3300045051 Bacteria 9100
166 Ga0451576_0015277 3300045051 Bacteria 8511
167 Ga0451576_0125445 3300045051 Bacteria 2675
168 Ga0451576_0132386 3300045051 Unclassified 2600
169 Ga0451576_0436990 3300045051 Bacteria 1373
170 Ga0451576_0502114 3300045051 Bacteria 1274
171 Ga0501032_0000834 3300049569 Bacteria 25067
172 Ga0501046_0002976 3300049580 Bacteria 15663
173 Ga0501047_0380599 3300049581 Bacteria 1246
174 Ga0501083_0034788 3300049744 Bacteria 3444
175 Ga0501044_0002000 3300049823 Bacteria 23541
176 Ga0501044_0770406 3300049823 Bacteria 843
177 Ga0500568_0034787 3300053139 Bacteria 2059

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005336 Ga0070680_100461361 Ga0070680_1004613612 110
2 3300003322 rootL2_10075442 rootL2_100754426 122
3 3300044656 Ga0466969_0413543 Ga0466969_0413543_18_392 122
4 3300044712 Ga0453684_0000019 Ga0453684_0000019_56208_56576 122
5 3300045051 Ga0451576_0000548 Ga0451576_0000548_63551_63943 130
6 iso_pu_bacteria 2786546940 2788434326 131
7 3300026116 Ga0207674_11075427 Ga0207674_110754272 132
8 3300003320 rootH2_10010124 rootH2_1001012457 133
9 3300003323 rootH1_10197980 rootH1_101979802 133
10 3300005577 Ga0068857_100026903 Ga0068857_1000269032 133
11 3300005614 Ga0068856_100384282 Ga0068856_1003842823 133
12 3300026078 Ga0207702_10285031 Ga0207702_102850312 133
13 3300026116 Ga0207674_10081465 Ga0207674_100814652 133
14 3300005327 Ga0070658_10546533 Ga0070658_105465332 134
15 3300005530 Ga0070679_100019648 Ga0070679_1000196482 134
16 3300025909 Ga0207705_10412631 Ga0207705_104126312 134
17 3300025917 Ga0207660_10814588 Ga0207660_108145882 134
18 3300025921 Ga0207652_10009610 Ga0207652_100096107 134
19 3300028556 Ga0265337_1006020 Ga0265337_10060203 134
20 3300028577 Ga0265318_10020686 Ga0265318_100206863 134
21 3300028654 Ga0265322_10002859 Ga0265322_100028593 134
22 3300028666 Ga0265336_10000828 Ga0265336_1000082813 134
23 3300028800 Ga0265338_10008277 Ga0265338_100082773 134
24 3300029957 Ga0265324_10001912 Ga0265324_100019123 134
25 3300031238 Ga0265332_10283595 Ga0265332_102835952 134
26 3300031239 Ga0265328_10097098 Ga0265328_100970981 134
27 3300031240 Ga0265320_10033279 Ga0265320_100332793 134
28 3300031241 Ga0265325_10052557 Ga0265325_100525573 134
29 3300031247 Ga0265340_10172900 Ga0265340_101729002 134
30 3300031251 Ga0265327_10003411 Ga0265327_1000341112 134
31 3300031344 Ga0265316_10002850 Ga0265316_1000285015 134
32 3300031711 Ga0265314_10001941 Ga0265314_1000194117 134
33 3300031712 Ga0265342_10157701 Ga0265342_101577012 134
34 3300044712 Ga0453684_1415919 Ga0453684_1415919_205_618 134
35 3300045051 Ga0451576_0502114 Ga0451576_0502114_119_526 134
36 3300003320 rootH2_10000634 rootH2_100006345 135
37 3300003322 rootL2_10059516 rootL2_100595167 135
38 3300003322 rootL2_10099330 rootL2_100993306 135
39 3300003323 rootH1_10228559 rootH1_102285593 135
40 3300005327 Ga0070658_10063238 Ga0070658_100632383 135
41 3300005329 Ga0070683_100027294 Ga0070683_1000272943 135
42 3300005329 Ga0070683_100166370 Ga0070683_1001663703 135
43 3300005329 Ga0070683_100814642 Ga0070683_1008146422 135
44 3300005334 Ga0068869_100544780 Ga0068869_1005447802 135
45 3300005468 Ga0070707_102300847 Ga0070707_1023008471 135
46 3300005530 Ga0070679_100006625 Ga0070679_1000066254 135
47 3300005535 Ga0070684_100235061 Ga0070684_1002350613 135
48 3300005539 Ga0068853_101864484 Ga0068853_1018644841 135
49 3300005563 Ga0068855_102230936 Ga0068855_1022309362 135
50 3300005614 Ga0068856_100000470 Ga0068856_10000047011 135
51 3300005614 Ga0068856_100598128 Ga0068856_1005981282 135
52 3300005843 Ga0068860_100695388 Ga0068860_1006953882 135
53 3300006028 Ga0070717_10000653 Ga0070717_1000065322 135
54 3300010375 Ga0105239_11959140 Ga0105239_119591402 135
55 3300013105 Ga0157369_10123589 Ga0157369_101235893 135
56 3300013296 Ga0157374_10774914 Ga0157374_107749142 135
57 3300014325 Ga0163163_10037465 Ga0163163_100374652 135
58 3300014325 Ga0163163_10044108 Ga0163163_100441085 135
59 3300014969 Ga0157376_10814605 Ga0157376_108146052 135
60 3300025909 Ga0207705_10276970 Ga0207705_102769702 135
61 3300025944 Ga0207661_10002709 Ga0207661_100027098 135
62 3300025944 Ga0207661_10002961 Ga0207661_100029615 135
63 3300025944 Ga0207661_10488035 Ga0207661_104880352 135
64 3300025949 Ga0207667_11394566 Ga0207667_113945661 135
65 3300026023 Ga0207677_11839430 Ga0207677_118394301 135
66 3300026078 Ga0207702_10000364 Ga0207702_1000036422 135
67 3300026078 Ga0207702_10749533 Ga0207702_107495332 135
68 3300026088 Ga0207641_10710034 Ga0207641_107100342 135
69 3300028381 Ga0268264_10976945 Ga0268264_109769452 135
70 3300028556 Ga0265337_1000413 Ga0265337_10004135 135
71 3300028556 Ga0265337_1009540 Ga0265337_10095403 135
72 3300028558 Ga0265326_10085259 Ga0265326_100852591 135
73 3300028563 Ga0265319_1000031 Ga0265319_100003144 135
74 3300028563 Ga0265319_1000601 Ga0265319_10006015 135
75 3300028563 Ga0265319_1002735 Ga0265319_10027357 135
76 3300028563 Ga0265319_1004019 Ga0265319_10040195 135
77 3300028563 Ga0265319_1014142 Ga0265319_10141422 135
78 3300028563 Ga0265319_1026978 Ga0265319_10269783 135
79 3300028573 Ga0265334_10008255 Ga0265334_100082553 135
80 3300028577 Ga0265318_10000999 Ga0265318_100009996 135
81 3300028577 Ga0265318_10001180 Ga0265318_100011809 135
82 3300028577 Ga0265318_10002767 Ga0265318_100027676 135
83 3300028653 Ga0265323_10005731 Ga0265323_100057315 135
84 3300028653 Ga0265323_10008446 Ga0265323_100084463 135
85 3300028653 Ga0265323_10014044 Ga0265323_100140444 135
86 3300028653 Ga0265323_10042121 Ga0265323_100421213 135
87 3300028653 Ga0265323_10044157 Ga0265323_100441572 135
88 3300028653 Ga0265323_10251029 Ga0265323_102510291 135
89 3300028654 Ga0265322_10017059 Ga0265322_100170593 135
90 3300028654 Ga0265322_10176019 Ga0265322_101760192 135
91 3300028666 Ga0265336_10030821 Ga0265336_100308212 135
92 3300028666 Ga0265336_10146873 Ga0265336_101468732 135
93 3300028794 Ga0307515_10257731 Ga0307515_102577313 135
94 3300028800 Ga0265338_10003810 Ga0265338_1000381018 135
95 3300028800 Ga0265338_10094353 Ga0265338_100943533 135
96 3300028800 Ga0265338_10791257 Ga0265338_107912572 135
97 3300029957 Ga0265324_10001218 Ga0265324_100012184 135
98 3300029957 Ga0265324_10292124 Ga0265324_102921241 135
99 3300031235 Ga0265330_10025056 Ga0265330_100250562 135
100 3300031235 Ga0265330_10047911 Ga0265330_100479113 135
101 3300031235 Ga0265330_10345416 Ga0265330_103454162 135
102 3300031238 Ga0265332_10037402 Ga0265332_100374023 135
103 3300031238 Ga0265332_10040591 Ga0265332_100405913 135
104 3300031238 Ga0265332_10229871 Ga0265332_102298712 135
105 3300031238 Ga0265332_10422925 Ga0265332_104229252 135
106 3300031239 Ga0265328_10026773 Ga0265328_100267732 135
107 3300031240 Ga0265320_10000674 Ga0265320_1000067417 135
108 3300031240 Ga0265320_10000682 Ga0265320_100006823 135
109 3300031240 Ga0265320_10002673 Ga0265320_1000267311 135
110 3300031240 Ga0265320_10038680 Ga0265320_100386803 135
111 3300031240 Ga0265320_10079357 Ga0265320_100793572 135
112 3300031240 Ga0265320_10112441 Ga0265320_101124412 135
113 3300031241 Ga0265325_10011948 Ga0265325_100119483 135
114 3300031241 Ga0265325_10055616 Ga0265325_100556163 135
115 3300031242 Ga0265329_10162849 Ga0265329_101628492 135
116 3300031247 Ga0265340_10116185 Ga0265340_101161853 135
117 3300031249 Ga0265339_10029815 Ga0265339_100298152 135
118 3300031250 Ga0265331_10126973 Ga0265331_101269732 135
119 3300031250 Ga0265331_10127195 Ga0265331_101271953 135
120 3300031251 Ga0265327_10000047 Ga0265327_10000047151 135
121 3300031251 Ga0265327_10002716 Ga0265327_100027166 135
122 3300031251 Ga0265327_10161896 Ga0265327_101618962 135
123 3300031344 Ga0265316_10049477 Ga0265316_100494774 135
124 3300031344 Ga0265316_10344511 Ga0265316_103445113 135
125 3300031595 Ga0265313_10000936 Ga0265313_1000093610 135
126 3300031595 Ga0265313_10009975 Ga0265313_100099754 135
127 3300031595 Ga0265313_10012793 Ga0265313_100127933 135
128 3300031595 Ga0265313_10048892 Ga0265313_100488923 135
129 3300031595 Ga0265313_10070924 Ga0265313_100709242 135
130 3300031595 Ga0265313_10227796 Ga0265313_102277962 135
131 3300031711 Ga0265314_10000902 Ga0265314_100009029 135
132 3300031711 Ga0265314_10035322 Ga0265314_100353224 135
133 3300031711 Ga0265314_10094414 Ga0265314_100944143 135
134 3300031711 Ga0265314_10107002 Ga0265314_101070023 135
135 3300031711 Ga0265314_10343435 Ga0265314_103434351 135
136 3300031711 Ga0265314_10359057 Ga0265314_103590572 135
137 3300031711 Ga0265314_10365591 Ga0265314_103655912 135
138 3300031712 Ga0265342_10028211 Ga0265342_100282114 135
139 3300031712 Ga0265342_10210920 Ga0265342_102109202 135
140 3300031712 Ga0265342_10446257 Ga0265342_104462572 135
141 3300031824 Ga0307413_10721860 Ga0307413_107218602 135
142 3300032004 Ga0307414_10594898 Ga0307414_105948982 135
143 3300032004 Ga0307414_11158347 Ga0307414_111583471 135
144 3300042004 Ga0439445_0010894 Ga0439445_0010894_310_723 135
145 3300042876 Ga0451577_0068049 Ga0451577_0068049_1607_2017 135
146 3300042876 Ga0451577_0115566 Ga0451577_0115566_680_1096 135
147 3300042876 Ga0451577_0302098 Ga0451577_0302098_449_862 135
148 3300042876 Ga0451577_0611457 Ga0451577_0611457_319_729 135
149 3300044673 Ga0453683_0000149 Ga0453683_0000149_72038_72448 135
150 3300044673 Ga0453683_0001319 Ga0453683_0001319_3902_4312 135
151 3300044673 Ga0453683_0022062 Ga0453683_0022062_93_503 135
152 3300044673 Ga0453683_0084036 Ga0453683_0084036_1286_1702 135
153 3300044673 Ga0453683_0362691 Ga0453683_0362691_139_552 135
154 3300044712 Ga0453684_0004529 Ga0453684_0004529_9927_10340 135
155 3300044712 Ga0453684_0013967 Ga0453684_0013967_5829_6236 135
156 3300044712 Ga0453684_0033619 Ga0453684_0033619_6438_6848 135
157 3300044712 Ga0453684_0063331 Ga0453684_0063331_2250_2657 135
158 3300044712 Ga0453684_0111589 Ga0453684_0111589_2571_2987 135
159 3300044712 Ga0453684_0189458 Ga0453684_0189458_1792_2202 135
160 3300044712 Ga0453684_0312525 Ga0453684_0312525_444_851 135
161 3300044712 Ga0453684_1533802 Ga0453684_1533802_61_474 135
162 3300044735 Ga0466968_0091044 Ga0466968_0091044_266_673 135
163 3300045051 Ga0451576_0000251 Ga0451576_0000251_51197_51613 135
164 3300045051 Ga0451576_0000586 Ga0451576_0000586_36652_37065 135
165 3300045051 Ga0451576_0003259 Ga0451576_0003259_10558_10974 135
166 3300045051 Ga0451576_0003534 Ga0451576_0003534_10838_11251 135
167 3300045051 Ga0451576_0013591 Ga0451576_0013591_2712_3122 135
168 3300045051 Ga0451576_0015277 Ga0451576_0015277_5298_5714 135
169 3300045051 Ga0451576_0125445 Ga0451576_0125445_1308_1715 135
170 3300045051 Ga0451576_0132386 Ga0451576_0132386_151_558 135
171 3300045051 Ga0451576_0436990 Ga0451576_0436990_732_1142 135
172 3300049569 Ga0501032_0000834 Ga0501032_0000834_15280_15693 135
173 3300049580 Ga0501046_0002976 Ga0501046_0002976_5915_6328 135
174 3300049581 Ga0501047_0380599 Ga0501047_0380599_201_614 135
175 3300049744 Ga0501083_0034788 Ga0501083_0034788_239_667 135
176 3300049823 Ga0501044_0002000 Ga0501044_0002000_13768_14181 135
177 3300049823 Ga0501044_0770406 Ga0501044_0770406_127_543 135
178 3300053139 Ga0500568_0034787 Ga0500568_0034787_36_452 135

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

20

146

0.96

Feature Viewer

pLDDT pTM Quality
71.4 0.49 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map