F272092

General Info

Members Datasets Scaffolds Average Seq Length
178 131 356 119

Family's Representative Sequence

Representative Sequence 3300021361|Ga0213872_10021101|Ga0213872_100211012
Length 132
Sequence METELFENLRLELRRGSLTLAVLAQLRTEHYGYALRKALESHGLAIDENTLYPLLRRLETQGLLVSHWREEDKRNKRFYRLSPDGEIILYRLLNEHEAMNAAIDRIMAPIPSPQPMETGFEPTVLEPKEQLQ

Samples

Sample ID Description Type Environment
1 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
58 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
79 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
80 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
81 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
82 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
83 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
84 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
85 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
86 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
87 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
88 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
89 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
90 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
91 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
92 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
93 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
94 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
95 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
96 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
102 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
103 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
104 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
105 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
106 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
107 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
108 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
109 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
110 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
111 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
112 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
113 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
114 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
115 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
116 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
117 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
118 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
119 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
122 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
123 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
124 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
125 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
126 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
127 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
128 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
129 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
130 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
131 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.56
Rhizosphere 98.31
Stem 0
Stem Tuber 0
Unclassified 33.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213872_10021101 3300021361 Bacteria 2999
2 Ga0068869_100018702 3300005334 Bacteria 4722
3 Ga0068868_101710776 3300005338 Bacteria 593
4 Ga0068868_102091419 3300005338 Unclassified 538
5 Ga0070689_100177566 3300005340 Unclassified 1728
6 Ga0070687_100855899 3300005343 Unclassified 648
7 Ga0070671_100000815 3300005355 Bacteria 22608
8 Ga0070673_100001668 3300005364 Bacteria 13152
9 Ga0070667_100021420 3300005367 Bacteria 5368
10 Ga0070708_101109284 3300005445 Unclassified 741
11 Ga0070678_100189150 3300005456 Bacteria 1691
12 Ga0068867_100773780 3300005459 Bacteria 854
13 Ga0070685_10342345 3300005466 Bacteria 1020
14 Ga0070685_10384948 3300005466 Bacteria 967
15 Ga0070685_10549418 3300005466 Bacteria 824
16 Ga0070698_100093523 3300005471 Bacteria 2986
17 Ga0070672_100010422 3300005543 Bacteria 6450
18 Ga0070686_100053557 3300005544 Bacteria 2577
19 Ga0070686_100864890 3300005544 Unclassified 733
20 Ga0070696_100840733 3300005546 Unclassified 758
21 Ga0070664_100038871 3300005564 Bacteria 4007
22 Ga0070702_100198151 3300005615 Bacteria 1327
23 Ga0070702_100705878 3300005615 Bacteria 769
24 Ga0068852_101023217 3300005616 Bacteria 845
25 Ga0068859_100052702 3300005617 Bacteria 4091
26 Ga0068859_100167575 3300005617 Bacteria 2277
27 Ga0068864_100041186 3300005618 Unclassified 3951
28 Ga0068863_100000203 3300005841 Bacteria 63485
29 Ga0068863_101533717 3300005841 Unclassified 675
30 Ga0068858_100004889 3300005842 Bacteria 13147
31 Ga0068860_100018055 3300005843 Bacteria 6868
32 Ga0068860_101281695 3300005843 Unclassified 753
33 Ga0068860_102119431 3300005843 Unclassified 583
34 Ga0068862_100724393 3300005844 Bacteria 965
35 Ga0097621_100791287 3300006237 Unclassified 878
36 Ga0068871_100036085 3300006358 Bacteria 3934
37 Ga0075428_100564963 3300006844 Unclassified 1216
38 Ga0075430_100139549 3300006846 Bacteria 2018
39 Ga0075431_100032772 3300006847 Bacteria 5355
40 Ga0075433_10009812 3300006852 Bacteria 7673
41 Ga0075434_100001730 3300006871 Bacteria 18736
42 Ga0068865_101209144 3300006881 Bacteria 669
43 Ga0075436_100177630 3300006914 Bacteria 1504
44 Ga0097620_100052702 3300006931 Bacteria 4091
45 Ga0097620_100167572 3300006931 Bacteria 2277
46 Ga0075435_100092406 3300007076 Bacteria 2499
47 Ga0105251_10334000 3300009011 Unclassified 690
48 Ga0105240_12694104 3300009093 Unclassified 513
49 Ga0111539_11369191 3300009094 Unclassified 821
50 Ga0105245_10181875 3300009098 Bacteria 2009
51 Ga0105245_10362052 3300009098 Bacteria 1440
52 Ga0105245_10850789 3300009098 Unclassified 952
53 Ga0105247_10416763 3300009101 Unclassified 961
54 Ga0114129_10731034 3300009147 Unclassified 1269
55 Ga0114129_10798589 3300009147 Bacteria 1204
56 Ga0105243_11441273 3300009148 Bacteria 710
57 Ga0105242_10563515 3300009176 Bacteria 1094
58 Ga0105248_10000321 3300009177 Bacteria 56694
59 Ga0105248_10097440 3300009177 Unclassified 3313
60 Ga0105248_10283182 3300009177 Bacteria 1866
61 Ga0105237_11717508 3300009545 Unclassified 635
62 Ga0105249_12873654 3300009553 Unclassified 553
63 Ga0105239_12267611 3300010375 Unclassified 632
64 Ga0163162_10003959 3300013306 Bacteria 14210
65 Ga0163162_10768662 3300013306 Bacteria 1082
66 Ga0157375_10000347 3300013308 Bacteria 41857
67 Ga0163163_10027071 3300014325 Bacteria 5487
68 Ga0163163_10089765 3300014325 Bacteria 3086
69 Ga0163163_10220282 3300014325 Bacteria 1946
70 Ga0163163_11087930 3300014325 Bacteria 862
71 Ga0157380_10847002 3300014326 Unclassified 936
72 Ga0157380_12753388 3300014326 Unclassified 558
73 Ga0157380_13437798 3300014326 Unclassified 507
74 Ga0157377_10529086 3300014745 Bacteria 829
75 Ga0157379_10000069 3300014968 Bacteria 64939
76 Ga0157379_10064888 3300014968 Bacteria 3263
77 Ga0157376_10453536 3300014969 Bacteria 1251
78 Ga0163161_10066581 3300017792 Bacteria 2631
79 Ga0213872_10128315 3300021361 Bacteria 1118
80 Ga0213872_10199770 3300021361 Bacteria 857
81 Ga0213875_10308821 3300021388 Unclassified 749
82 Ga0207654_10480314 3300025911 Unclassified 875
83 Ga0207662_10988891 3300025918 Unclassified 597
84 Ga0207694_10694599 3300025924 Unclassified 858
85 Ga0207659_10000803 3300025926 Bacteria 18571
86 Ga0207687_10491410 3300025927 Unclassified 1023
87 Ga0207644_10014227 3300025931 Bacteria 5321
88 Ga0207670_10209264 3300025936 Bacteria 1486
89 Ga0207670_10370672 3300025936 Unclassified 1138
90 Ga0207670_11432044 3300025936 Unclassified 587
91 Ga0207691_10019810 3300025940 Bacteria 6363
92 Ga0207711_10002805 3300025941 Bacteria 15317
93 Ga0207689_10027902 3300025942 Bacteria 4723
94 Ga0207689_11678244 3300025942 Bacteria 527
95 Ga0207679_10012329 3300025945 Bacteria 5572
96 Ga0207651_10032609 3300025960 Bacteria 3349
97 Ga0207712_11760319 3300025961 Unclassified 555
98 Ga0207658_10032650 3300025986 Bacteria 3707
99 Ga0207703_10154869 3300026035 Bacteria 2002
100 Ga0207641_10001413 3300026088 Bacteria 23683
101 Ga0207641_11348803 3300026088 Unclassified 714
102 Ga0207676_10168003 3300026095 Bacteria 1908
103 Ga0207698_11421251 3300026142 Bacteria 709
104 Ga0209974_10315968 3300027876 Unclassified 600
105 Ga0268264_10010208 3300028381 Bacteria 7773
106 Ga0268264_11862488 3300028381 Unclassified 611
107 Ga0265334_10351043 3300028573 Unclassified 504
108 Ga0265323_10064921 3300028653 Bacteria 1260
109 Ga0265330_10107863 3300031235 Bacteria 1190
110 Ga0265332_10390542 3300031238 Unclassified 575
111 Ga0265325_10002887 3300031241 Bacteria 11453
112 Ga0265325_10330083 3300031241 Unclassified 676
113 Ga0265316_11265651 3300031344 Unclassified 510
114 Ga0265313_10098924 3300031595 Unclassified 1297
115 Ga0316579_10618397 3300031691 Bacteria 524
116 Ga0265314_10211846 3300031711 Unclassified 1137
117 Ga0373948_0151051 3300034817 Bacteria 580
118 Ga0373939_0051710 3300035114 Unclassified 1278
119 Ga0373954_0646075 3300035118 Unclassified 524
120 Ga0373943_0001766 3300035170 Bacteria 9785
121 Ga0373946_0023682 3300035171 Bacteria 2401
122 Ga0373955_0003851 3300035172 Bacteria 6615
123 Ga0373924_0025092 3300035410 Bacteria 2355
124 Ga0373931_0791274 3300035691 Unclassified 632
125 Ga0373935_0307137 3300035692 Bacteria 1122
126 Ga0373935_0581371 3300035692 Bacteria 818
127 Ga0373947_0043937 3300035725 Unclassified 2670
128 Ga0373937_0274982 3300036401 Bacteria 1590
129 Ga0373937_0580101 3300036401 Bacteria 1065
130 Ga0373925_0024101 3300037068 Bacteria 4442
131 Ga0373925_0761356 3300037068 Bacteria 798
132 Ga0436364_0252022 3300037853 Bacteria 2273
133 Ga0395901_1883540 3300038443 Bacteria 546
134 Ga0436360_0046019 3300039438 Bacteria 3850
135 Ga0436360_0086435 3300039438 Bacteria 1231
136 Ga0436360_0671893 3300039438 Unclassified 809
137 Ga0436360_1099358 3300039438 Bacteria 2899
138 Ga0436361_0102748 3300039447 Bacteria 34171
139 Ga0436361_0274001 3300039447 Bacteria 1881
140 Ga0436361_0287050 3300039447 Bacteria 1832
141 Ga0436361_1074426 3300039447 Bacteria 25236
142 Ga0436362_0323429 3300039453 Unclassified 609
143 Ga0436362_1158724 3300039453 Unclassified 1037
144 Ga0439454_022367 3300042011 Bacteria 942
145 Ga0495651_0038081 3300046462 Unclassified 3745
146 Ga0495582_0027569 3300046473 Bacteria 3114
147 Ga0495652_0495590 3300046529 Unclassified 848
148 Ga0495586_0171242 3300046535 Bacteria 1227
149 Ga0495645_0254398 3300046543 Bacteria 1166
150 Ga0495645_0392380 3300046543 Bacteria 886
151 Ga0495667_0574933 3300046559 Unclassified 703
152 Ga0495599_0269133 3300046678 Unclassified 1034
153 Ga0495658_0001448 3300046683 Bacteria 12486
154 Ga0495669_0003101 3300046684 Bacteria 6834
155 Ga0495613_0379315 3300046689 Bacteria 967
156 Ga0495604_0215843 3300047317 Bacteria 1323
157 Ga0495604_1025530 3300047317 Unclassified 509
158 Ga0495674_0097872 3300047319 Unclassified 2499
159 Ga0495674_0227894 3300047319 Bacteria 1539
160 Ga0495674_0285809 3300047319 Bacteria 1350
161 Ga0495674_0666992 3300047319 Unclassified 819
162 Ga0495680_0826449 3300047322 Unclassified 603
163 Ga0495675_0066112 3300047444 Bacteria 2286
164 Ga0495684_0226983 3300047471 Bacteria 1367
165 Ga0495684_0314997 3300047471 Bacteria 1120
166 Ga0496108_1282780 3300048911 Bacteria 617
167 Ga0501072_0173775 3300049588 Bacteria 1719
168 Ga0501073_0676961 3300049589 Bacteria 712
169 Ga0501076_1642616 3300049592 Bacteria 527
170 nmdc:mga05p37_336405_c1 3300050507 Bacteria 1781
171 nmdc:mga05p37_669969_c1 3300050507 Unclassified 1158
172 nmdc:mga06r32_486910_c1 3300050510 Bacteria 1211
173 nmdc:mga0n895_89630_c1 3300050512 Bacteria 3077
174 nmdc:mga0rr50_162072_c1 3300050513 Unclassified 1816
175 nmdc:mga08x19_161434_c1 3300050514 Bacteria 1522
176 nmdc:mga0a205_21637_c1 3300050515 Bacteria 6081
177 Ga0495601_0395363 3300053077 Unclassified 896
178 Ga0495619_0089561 3300053085 Bacteria 2082
179 Ga0213872_10021101
180 Ga0068869_100018702
181 Ga0068868_101710776
182 Ga0068868_102091419
183 Ga0070689_100177566
184 Ga0070687_100855899
185 Ga0070671_100000815
186 Ga0070673_100001668
187 Ga0070667_100021420
188 Ga0070708_101109284
189 Ga0070678_100189150
190 Ga0068867_100773780
191 Ga0070685_10342345
192 Ga0070685_10384948
193 Ga0070685_10549418
194 Ga0070698_100093523
195 Ga0070672_100010422
196 Ga0070686_100053557
197 Ga0070686_100864890
198 Ga0070696_100840733
199 Ga0070664_100038871
200 Ga0070702_100198151
201 Ga0070702_100705878
202 Ga0068852_101023217
203 Ga0068859_100052702
204 Ga0068859_100167575
205 Ga0068864_100041186
206 Ga0068863_100000203
207 Ga0068863_101533717
208 Ga0068858_100004889
209 Ga0068860_100018055
210 Ga0068860_101281695
211 Ga0068860_102119431
212 Ga0068862_100724393
213 Ga0097621_100791287
214 Ga0068871_100036085
215 Ga0075428_100564963
216 Ga0075430_100139549
217 Ga0075431_100032772
218 Ga0075433_10009812
219 Ga0075434_100001730
220 Ga0068865_101209144
221 Ga0075436_100177630
222 Ga0097620_100052702
223 Ga0097620_100167572
224 Ga0075435_100092406
225 Ga0105251_10334000
226 Ga0105240_12694104
227 Ga0111539_11369191
228 Ga0105245_10181875
229 Ga0105245_10362052
230 Ga0105245_10850789
231 Ga0105247_10416763
232 Ga0114129_10731034
233 Ga0114129_10798589
234 Ga0105243_11441273
235 Ga0105242_10563515
236 Ga0105248_10000321
237 Ga0105248_10097440
238 Ga0105248_10283182
239 Ga0105237_11717508
240 Ga0105249_12873654
241 Ga0105239_12267611
242 Ga0163162_10003959
243 Ga0163162_10768662
244 Ga0157375_10000347
245 Ga0163163_10027071
246 Ga0163163_10089765
247 Ga0163163_10220282
248 Ga0163163_11087930
249 Ga0157380_10847002
250 Ga0157380_12753388
251 Ga0157380_13437798
252 Ga0157377_10529086
253 Ga0157379_10000069
254 Ga0157379_10064888
255 Ga0157376_10453536
256 Ga0163161_10066581
257 Ga0213872_10128315
258 Ga0213872_10199770
259 Ga0213875_10308821
260 Ga0207654_10480314
261 Ga0207662_10988891
262 Ga0207694_10694599
263 Ga0207659_10000803
264 Ga0207687_10491410
265 Ga0207644_10014227
266 Ga0207670_10209264
267 Ga0207670_10370672
268 Ga0207670_11432044
269 Ga0207691_10019810
270 Ga0207711_10002805
271 Ga0207689_10027902
272 Ga0207689_11678244
273 Ga0207679_10012329
274 Ga0207651_10032609
275 Ga0207712_11760319
276 Ga0207658_10032650
277 Ga0207703_10154869
278 Ga0207641_10001413
279 Ga0207641_11348803
280 Ga0207676_10168003
281 Ga0207698_11421251
282 Ga0209974_10315968
283 Ga0268264_10010208
284 Ga0268264_11862488
285 Ga0265334_10351043
286 Ga0265323_10064921
287 Ga0265330_10107863
288 Ga0265332_10390542
289 Ga0265325_10002887
290 Ga0265325_10330083
291 Ga0265316_11265651
292 Ga0265313_10098924
293 Ga0316579_10618397
294 Ga0265314_10211846
295 Ga0373948_0151051
296 Ga0373939_0051710
297 Ga0373954_0646075
298 Ga0373943_0001766
299 Ga0373946_0023682
300 Ga0373955_0003851
301 Ga0373924_0025092
302 Ga0373931_0791274
303 Ga0373935_0307137
304 Ga0373935_0581371
305 Ga0373947_0043937
306 Ga0373937_0274982
307 Ga0373937_0580101
308 Ga0373925_0024101
309 Ga0373925_0761356
310 Ga0436364_0252022
311 Ga0395901_1883540
312 Ga0436360_0046019
313 Ga0436360_0086435
314 Ga0436360_0671893
315 Ga0436360_1099358
316 Ga0436361_0102748
317 Ga0436361_0274001
318 Ga0436361_0287050
319 Ga0436361_1074426
320 Ga0436362_0323429
321 Ga0436362_1158724
322 Ga0439454_022367
323 Ga0495651_0038081
324 Ga0495582_0027569
325 Ga0495652_0495590
326 Ga0495586_0171242
327 Ga0495645_0254398
328 Ga0495645_0392380
329 Ga0495667_0574933
330 Ga0495599_0269133
331 Ga0495658_0001448
332 Ga0495669_0003101
333 Ga0495613_0379315
334 Ga0495604_0215843
335 Ga0495604_1025530
336 Ga0495674_0097872
337 Ga0495674_0227894
338 Ga0495674_0285809
339 Ga0495674_0666992
340 Ga0495680_0826449
341 Ga0495675_0066112
342 Ga0495684_0226983
343 Ga0495684_0314997
344 Ga0496108_1282780
345 Ga0501072_0173775
346 Ga0501073_0676961
347 Ga0501076_1642616
348 nmdc:mga05p37_336405_c1
349 nmdc:mga05p37_669969_c1
350 nmdc:mga06r32_486910_c1
351 nmdc:mga0n895_89630_c1
352 nmdc:mga0rr50_162072_c1
353 nmdc:mga08x19_161434_c1
354 nmdc:mga0a205_21637_c1
355 Ga0495601_0395363
356 Ga0495619_0089561

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

19

91

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ejo-assembly1.cif.gz_A-2 crystal structure of padr family transcriptional regulator from eggerthella lenta dsm 2243 0.9531 4 109
4ejo-assembly2.cif.gz_B-3 crystal structure of padr family transcriptional regulator from eggerthella lenta dsm 2243 0.9404 4 110
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9379 10 107
6abq-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.9333 12 107
5dym-assembly1.cif.gz_A-2 crystal structure of a padr family transcription regulator from hypervirulent clostridium difficile r20291 - cdpadr_0991 to 1.89 angstrom resolution 0.9255 17 106
ID Description Score Start End Superfamily
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9354 12 106 1.10.10.10
5dymA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9254 17 106 1.10.10.10
5x11A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9189 18 93 1.10.10.10
4ejoA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9158 1 109 1.10.10.10
3hhhA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.91 10 105 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1S6FNF3-F1-model_v4 PadR family transcriptional regulator 1.002 6 107
AF-A0A6G7EJF0-F1-model_v4 PadR family transcriptional regulator 0.9987 4 106 GO:0003677
AF-A0A0B4D1P1-F1-model_v4 PadR family transcriptional regulator 0.9987 4 106
AF-A0A2D8FSD1-F1-model_v4 PadR family transcriptional regulator 0.9983 4 106
AF-A0A2N9L747-F1-model_v4 Transcriptional regulator, PadR family 0.9967 4 106

Map