F271951

General Info

Members Datasets Scaffolds Average Seq Length
178 126 356 193

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10803286|Ga0105242_108032861
Length 213
Sequence VLTTAFREYEAVAQLSSAESELIVRDARAWRAWLAKHHAEQDGVWLVLAKKGTVKPTSLVYDDALEEALCHGWIDGQVKRRDETTYKQRFTPRRKRSPWSKRNVGIAERLVAEGRMHDAGVAEIERAKSDGRWEAAYAGPATIEVPDDLAKALAANPKALRMFEQLTKQNRYAVLYRMTTAKRAETRERRIGEFVAMLARGETPYPQKRRSDV

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
15 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
16 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
17 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
18 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
19 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
20 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
21 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
22 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
23 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
24 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
25 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
26 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
27 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
28 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
29 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
30 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
31 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
50 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
51 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
52 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
53 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
54 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
55 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
56 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
57 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
58 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
59 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
60 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
61 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
62 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
63 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
64 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
65 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
66 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
67 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
68 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
69 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
70 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
71 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
72 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
73 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
74 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
75 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
76 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
77 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
78 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
79 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
80 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
81 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
82 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
83 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
84 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
85 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
86 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
87 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
88 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
89 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
90 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
91 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
92 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
93 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
94 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
95 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
96 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
97 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
98 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
99 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
100 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
101 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
102 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
103 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
104 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
105 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
106 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
107 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
110 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
111 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
112 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
113 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
114 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
115 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
116 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
117 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
118 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
119 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
120 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
121 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
122 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
123 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
124 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
125 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
126 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.88
Metatranscriptomes 1.12
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 17.98
Rhizosphere 80.9
Stem 0
Stem Tuber 0
Unclassified 3.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10803286 3300009176 Bacteria 931
2 Ga0070658_10333334 3300005327 Bacteria 1297
3 Ga0070658_10336014 3300005327 Bacteria 1291
4 Ga0070680_100212696 3300005336 Bacteria 1631
5 Ga0070682_100395936 3300005337 Bacteria 1043
6 Ga0068868_100471741 3300005338 Bacteria 1095
7 Ga0070661_100135824 3300005344 Unclassified 1851
8 Ga0070674_100335057 3300005356 Bacteria 1217
9 Ga0070673_100159167 3300005364 Bacteria 1919
10 Ga0070659_100713801 3300005366 Bacteria 868
11 Ga0070714_100002748 3300005435 Bacteria 12962
12 Ga0070714_100021451 3300005435 Bacteria 5285
13 Ga0070714_100388517 3300005435 Bacteria 1317
14 Ga0070710_10358701 3300005437 Bacteria 967
15 Ga0070711_100086056 3300005439 Bacteria 2253
16 Ga0070711_100879382 3300005439 Unclassified 764
17 Ga0068856_100901192 3300005614 Bacteria 903
18 Ga0070717_10040200 3300006028 Bacteria 3809
19 Ga0070716_100182397 3300006173 Unclassified 1379
20 Ga0070712_100050948 3300006175 Bacteria 2883
21 Ga0070712_100163303 3300006175 Bacteria 1722
22 Ga0070712_100530535 3300006175 Unclassified 990
23 Ga0075433_10324799 3300006852 Bacteria 1361
24 Ga0075434_100102027 3300006871 Bacteria 2876
25 Ga0075435_100082122 3300007076 Bacteria 2649
26 Ga0099794_10000105 3300007265 Bacteria 30999
27 Ga0105243_10496082 3300009148 Bacteria 1156
28 Ga0105242_10703716 3300009176 Bacteria 989
29 Ga0105242_10928002 3300009176 Bacteria 873
30 Ga0105246_10683787 3300011119 Bacteria 897
31 Ga0157373_10597441 3300013100 Bacteria 803
32 Ga0157371_10103760 3300013102 Bacteria 2017
33 Ga0157369_10006111 3300013105 Bacteria 13975
34 Ga0157372_10145673 3300013307 Bacteria 2731
35 Ga0157372_10596992 3300013307 Bacteria 1287
36 Ga0157375_10255196 3300013308 Unclassified 1915
37 Ga0157375_10951234 3300013308 Bacteria 1001
38 Ga0157380_10869911 3300014326 Bacteria 925
39 Ga0157379_10244442 3300014968 Bacteria 1628
40 Ga0157376_10768995 3300014969 Bacteria 974
41 Ga0206354_11284116 3300020081 Bacteria 1355
42 Ga0206353_11389424 3300020082 Bacteria 885
43 Ga0207692_10001628 3300025898 Bacteria 8475
44 Ga0207699_10152187 3300025906 Bacteria 1532
45 Ga0207705_10095100 3300025909 Bacteria 2186
46 Ga0207693_10006469 3300025915 Bacteria 9707
47 Ga0207693_10177201 3300025915 Bacteria 1677
48 Ga0207663_10032622 3300025916 Bacteria 3094
49 Ga0207660_10130462 3300025917 Bacteria 1913
50 Ga0207649_10037505 3300025920 Bacteria 2928
51 Ga0207652_10011346 3300025921 Bacteria 7180
52 Ga0207664_10003964 3300025929 Bacteria 9964
53 Ga0207664_10055992 3300025929 Bacteria 3131
54 Ga0207690_10009290 3300025932 Bacteria 5843
55 Ga0207711_10618921 3300025941 Bacteria 1010
56 Ga0207639_10104849 3300026041 Bacteria 2293
57 Ga0207678_10258241 3300026067 Bacteria 1493
58 Ga0207675_100056353 3300026118 Bacteria 3666
59 Ga0207698_10261061 3300026142 Bacteria 1591
60 Ga0209588_1000097 3300027671 Bacteria 27582
61 Ga0265338_10464373 3300028800 Bacteria 895
62 Ga0316177_1012373 3300030731 Bacteria 3659
63 Ga0316176_1075805 3300030732 Bacteria 3262
64 Ga0314311_1052216 3300030733 Bacteria 6226
65 Ga0307509_10110063 3300031507 Bacteria 2762
66 Ga0373937_0035446 3300036401 Bacteria 4542
67 Ga0395899_0052039 3300037312 Bacteria 3037
68 Ga0395899_0286619 3300037312 Bacteria 1119
69 Ga0395900_0006932 3300037418 Bacteria 11757
70 Ga0395900_0060668 3300037418 Bacteria 3891
71 Ga0395898_0013815 3300037466 Bacteria 8301
72 Ga0395905_0035638 3300037471 Bacteria 4672
73 Ga0395905_0056346 3300037471 Bacteria 3677
74 Ga0395905_0538203 3300037471 Bacteria 1069
75 Ga0395901_0089477 3300038443 Bacteria 3222
76 Ga0395901_0114498 3300038443 Bacteria 2832
77 Ga0395901_0119259 3300038443 Bacteria 2772
78 Ga0395901_0884507 3300038443 Bacteria 876
79 Ga0242420_038397 3300038996 Bacteria 909
80 Ga0466965_0177243 3300044683 Bacteria 1123
81 Ga0466966_0060392 3300044684 Bacteria 2393
82 Ga0466961_0064296 3300044693 Bacteria 2331
83 Ga0466961_0122275 3300044693 Bacteria 1634
84 Ga0466963_0053529 3300044694 Bacteria 2679
85 Ga0466963_0079492 3300044694 Bacteria 2219
86 Ga0466963_0548090 3300044694 Bacteria 817
87 Ga0466968_0013810 3300044735 Bacteria 3180
88 Ga0466957_0064857 3300044842 Bacteria 2248
89 Ga0466957_0166225 3300044842 Bacteria 1435
90 Ga0466957_0233340 3300044842 Bacteria 1219
91 Ga0466957_0328963 3300044842 Bacteria 1032
92 Ga0466960_0025474 3300044901 Bacteria 2677
93 Ga0466959_0035738 3300045049 Bacteria 3672
94 Ga0466959_0085210 3300045049 Bacteria 2274
95 Ga0466959_0194157 3300045049 Bacteria 1416
96 Ga0451576_0302496 3300045051 Bacteria 1673
97 Ga0466958_0138463 3300045836 Bacteria 1532
98 Ga0466958_0270390 3300045836 Bacteria 1088
99 Ga0466967_0024948 3300045976 Bacteria 4922
100 Ga0466967_0186557 3300045976 Bacteria 1958
101 Ga0466967_0240881 3300045976 Bacteria 1725
102 Ga0466967_0737021 3300045976 Bacteria 977
103 Ga0495592_0111563 3300046454 Bacteria 1935
104 Ga0495591_100434 3300046458 Bacteria 718
105 Ga0495629_0061771 3300046459 Bacteria 2618
106 Ga0495580_0626166 3300046472 Bacteria 709
107 Ga0495639_0248310 3300046475 Bacteria 879
108 Ga0495662_0500696 3300046476 Bacteria 596
109 Ga0495584_0061796 3300046491 Unclassified 1883
110 Ga0495630_0382422 3300046517 Bacteria 1078
111 Ga0495644_0094810 3300046523 Bacteria 1127
112 Ga0495586_0356430 3300046535 Bacteria 840
113 Ga0495633_0267153 3300046558 Bacteria 779
114 Ga0495656_0406695 3300046615 Bacteria 712
115 Ga0495634_0032452 3300046642 Bacteria 3592
116 Ga0495658_0139329 3300046683 Bacteria 1482
117 Ga0495589_0215830 3300046794 Bacteria 902
118 Ga0495636_0238818 3300047318 Bacteria 838
119 Ga0495674_0230640 3300047319 Bacteria 1528
120 Ga0495674_0495943 3300047319 Bacteria 977
121 Ga0495676_0169683 3300047321 Bacteria 1537
122 Ga0495680_0274368 3300047322 Bacteria 1190
123 Ga0495684_0065627 3300047471 Bacteria 2759
124 Ga0496100_0169426 3300048903 Bacteria 1571
125 Ga0496100_0576252 3300048903 Bacteria 872
126 Ga0496101_0078153 3300048904 Bacteria 2440
127 Ga0496101_0136089 3300048904 Bacteria 1869
128 Ga0496101_0143017 3300048904 Bacteria 1825
129 Ga0496102_0088564 3300048905 Bacteria 2862
130 Ga0496104_0000001 3300048907 Bacteria 711867
131 Ga0496104_0016217 3300048907 Bacteria 6764
132 Ga0496104_0033780 3300048907 Bacteria 4767
133 Ga0496105_0000114 3300048908 Bacteria 54319
134 Ga0496105_0017650 3300048908 Bacteria 5725
135 Ga0496106_0113775 3300048909 Bacteria 2110
136 Ga0496107_0235283 3300048910 Bacteria 1363
137 Ga0496107_0392547 3300048910 Bacteria 1032
138 Ga0496108_0008835 3300048911 Bacteria 8165
139 Ga0496108_0144047 3300048911 Bacteria 2053
140 Ga0496109_0003191 3300048912 Bacteria 13643
141 Ga0496109_0032382 3300048912 Bacteria 4699
142 Ga0496109_0667480 3300048912 Bacteria 977
143 Ga0496110_0000017 3300048913 Bacteria 83678
144 Ga0496110_0003521 3300048913 Bacteria 12017
145 Ga0496110_0314714 3300048913 Bacteria 1425
146 Ga0496111_0000003 3300048914 Bacteria 116144
147 Ga0496111_0000134 3300048914 Bacteria 32642
148 Ga0496111_0001000 3300048914 Bacteria 15484
149 Ga0496112_0035706 3300048915 Bacteria 4845
150 Ga0496113_0029928 3300048916 Bacteria 3937
151 Ga0496113_0042620 3300048916 Bacteria 3355
152 Ga0496114_0065215 3300048917 Bacteria 3051
153 Ga0496114_0104742 3300048917 Bacteria 2419
154 Ga0496115_0000199 3300048918 Bacteria 56119
155 Ga0496115_0022333 3300048918 Bacteria 4901
156 Ga0501040_0116040 3300049576 Bacteria 1875
157 Ga0501047_0091506 3300049581 Bacteria 2920
158 Ga0501067_0056776 3300049583 Bacteria 2168
159 Ga0501067_0479348 3300049583 Bacteria 695
160 Ga0501074_0039447 3300049590 Bacteria 3421
161 Ga0501077_0121051 3300049593 Bacteria 1659
162 Ga0501079_0037638 3300049741 Bacteria 3729
163 Ga0501080_0190956 3300049742 Bacteria 1882
164 Ga0501081_0032519 3300049743 Bacteria 3539
165 Ga0501083_0213383 3300049744 Bacteria 1258
166 Ga0501045_0520303 3300049824 Bacteria 883
167 nmdc:mga0n895_271636_c1 3300050512 Bacteria 1720
168 nmdc:mga0rr50_291483_c1 3300050513 Bacteria 1364
169 nmdc:mga08x19_141131_c1 3300050514 Bacteria 1627
170 nmdc:mga0a205_203914_c1 3300050515 Bacteria 1867
171 Ga0495612_0259087 3300053078 Bacteria 775
172 Ga0495595_0113779 3300053084 Bacteria 1314
173 Ga0495619_0209780 3300053085 Bacteria 1349
174 Ga0500616_0031358 3300053153 Bacteria 2912
175 Ga0501084_0224171 3300054114 Bacteria 1586
176 Ga0466962_0028129 3300061719 Bacteria 2694
177 Ga0466962_0040472 3300061719 Bacteria 2231
178 Ga0466962_0088162 3300061719 Bacteria 1486
179 Ga0105242_10803286
180 Ga0070658_10333334
181 Ga0070658_10336014
182 Ga0070680_100212696
183 Ga0070682_100395936
184 Ga0068868_100471741
185 Ga0070661_100135824
186 Ga0070674_100335057
187 Ga0070673_100159167
188 Ga0070659_100713801
189 Ga0070714_100002748
190 Ga0070714_100021451
191 Ga0070714_100388517
192 Ga0070710_10358701
193 Ga0070711_100086056
194 Ga0070711_100879382
195 Ga0068856_100901192
196 Ga0070717_10040200
197 Ga0070716_100182397
198 Ga0070712_100050948
199 Ga0070712_100163303
200 Ga0070712_100530535
201 Ga0075433_10324799
202 Ga0075434_100102027
203 Ga0075435_100082122
204 Ga0099794_10000105
205 Ga0105243_10496082
206 Ga0105242_10703716
207 Ga0105242_10928002
208 Ga0105246_10683787
209 Ga0157373_10597441
210 Ga0157371_10103760
211 Ga0157369_10006111
212 Ga0157372_10145673
213 Ga0157372_10596992
214 Ga0157375_10255196
215 Ga0157375_10951234
216 Ga0157380_10869911
217 Ga0157379_10244442
218 Ga0157376_10768995
219 Ga0206354_11284116
220 Ga0206353_11389424
221 Ga0207692_10001628
222 Ga0207699_10152187
223 Ga0207705_10095100
224 Ga0207693_10006469
225 Ga0207693_10177201
226 Ga0207663_10032622
227 Ga0207660_10130462
228 Ga0207649_10037505
229 Ga0207652_10011346
230 Ga0207664_10003964
231 Ga0207664_10055992
232 Ga0207690_10009290
233 Ga0207711_10618921
234 Ga0207639_10104849
235 Ga0207678_10258241
236 Ga0207675_100056353
237 Ga0207698_10261061
238 Ga0209588_1000097
239 Ga0265338_10464373
240 Ga0316177_1012373
241 Ga0316176_1075805
242 Ga0314311_1052216
243 Ga0307509_10110063
244 Ga0373937_0035446
245 Ga0395899_0052039
246 Ga0395899_0286619
247 Ga0395900_0006932
248 Ga0395900_0060668
249 Ga0395898_0013815
250 Ga0395905_0035638
251 Ga0395905_0056346
252 Ga0395905_0538203
253 Ga0395901_0089477
254 Ga0395901_0114498
255 Ga0395901_0119259
256 Ga0395901_0884507
257 Ga0242420_038397
258 Ga0466965_0177243
259 Ga0466966_0060392
260 Ga0466961_0064296
261 Ga0466961_0122275
262 Ga0466963_0053529
263 Ga0466963_0079492
264 Ga0466963_0548090
265 Ga0466968_0013810
266 Ga0466957_0064857
267 Ga0466957_0166225
268 Ga0466957_0233340
269 Ga0466957_0328963
270 Ga0466960_0025474
271 Ga0466959_0035738
272 Ga0466959_0085210
273 Ga0466959_0194157
274 Ga0451576_0302496
275 Ga0466958_0138463
276 Ga0466958_0270390
277 Ga0466967_0024948
278 Ga0466967_0186557
279 Ga0466967_0240881
280 Ga0466967_0737021
281 Ga0495592_0111563
282 Ga0495591_100434
283 Ga0495629_0061771
284 Ga0495580_0626166
285 Ga0495639_0248310
286 Ga0495662_0500696
287 Ga0495584_0061796
288 Ga0495630_0382422
289 Ga0495644_0094810
290 Ga0495586_0356430
291 Ga0495633_0267153
292 Ga0495656_0406695
293 Ga0495634_0032452
294 Ga0495658_0139329
295 Ga0495589_0215830
296 Ga0495636_0238818
297 Ga0495674_0230640
298 Ga0495674_0495943
299 Ga0495676_0169683
300 Ga0495680_0274368
301 Ga0495684_0065627
302 Ga0496100_0169426
303 Ga0496100_0576252
304 Ga0496101_0078153
305 Ga0496101_0136089
306 Ga0496101_0143017
307 Ga0496102_0088564
308 Ga0496104_0000001
309 Ga0496104_0016217
310 Ga0496104_0033780
311 Ga0496105_0000114
312 Ga0496105_0017650
313 Ga0496106_0113775
314 Ga0496107_0235283
315 Ga0496107_0392547
316 Ga0496108_0008835
317 Ga0496108_0144047
318 Ga0496109_0003191
319 Ga0496109_0032382
320 Ga0496109_0667480
321 Ga0496110_0000017
322 Ga0496110_0003521
323 Ga0496110_0314714
324 Ga0496111_0000003
325 Ga0496111_0000134
326 Ga0496111_0001000
327 Ga0496112_0035706
328 Ga0496113_0029928
329 Ga0496113_0042620
330 Ga0496114_0065215
331 Ga0496114_0104742
332 Ga0496115_0000199
333 Ga0496115_0022333
334 Ga0501040_0116040
335 Ga0501047_0091506
336 Ga0501067_0056776
337 Ga0501067_0479348
338 Ga0501074_0039447
339 Ga0501077_0121051
340 Ga0501079_0037638
341 Ga0501080_0190956
342 Ga0501081_0032519
343 Ga0501083_0213383
344 Ga0501045_0520303
345 nmdc:mga0n895_271636_c1
346 nmdc:mga0rr50_291483_c1
347 nmdc:mga08x19_141131_c1
348 nmdc:mga0a205_203914_c1
349 Ga0495612_0259087
350 Ga0495595_0113779
351 Ga0495619_0209780
352 Ga0500616_0031358
353 Ga0501084_0224171
354 Ga0466962_0028129
355 Ga0466962_0040472
356 Ga0466962_0088162

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13376

OmdA

Bacteriocin-protection, YdeI or OmpD-Associated

142

201

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bie-assembly1.cif.gz_B o-methyltransferase plu4894 in complex with sah 0.7844 27 74
8bij-assembly1.cif.gz_B o-methyltransferase plu4894 (mutant i88m, w91l, c97y, s142l, g146v, y258m, l270f, s309y) in complex with sah 0.778 27 74
8bif-assembly2.cif.gz_C o-methyltransferase plu4892 in complex with sah 0.7726 27 74
8bgt-assembly1.cif.gz_A o-methyltransferase plu4890 in complex with sam 0.7636 11 74
6c5b-assembly1.cif.gz_B crystal structure analysis of laphzm 0.7412 5 74
ID Description Score Start End Superfamily
af_Q7ZVJ8_3_201_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7609 27 71 3.40.50.150
af_E7F5V3_1114_1412_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7428 27 74 3.40.50.150
6c5bB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7412 5 74 3.40.50.150
af_K7UB55_132_405_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7296 5 73 3.40.50.150
af_O95671_369_620_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7277 5 73 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1H6DSJ6-F1-model_v4 Bacteriocin-protection, YdeI or OmpD-Associated 0.9925 6 115
AF-A0A5D0NRV7-F1-model_v4 Bacteriocin-protection protein 0.9832 6 109
AF-A0A1M4EQW4-F1-model_v4 Putative periplasmic membrane protein 0.978 6 104
AF-A0A7Y5H9Y0-F1-model_v4 YdeI/OmpD-associated family protein 0.9747 125 185
AF-A0A1M7QNZ7-F1-model_v4 Bacteriocin-protection, YdeI or OmpD-Associated 0.9698 123 185

Map