F271806

General Info

Members Datasets Scaffolds Average Seq Length
178 123 356 159

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100000424|Ga0075428_10000042417
Length 148
Sequence MTSRVKGVPEGASVVIPRLFCRDPAAQIEFCLTTFGAVELNRRPGPDGQVAHALITIGPAMLMIESEWPQITSPVALYVYVEKVDDTVARARAAGATILMPPTDQFWGDRTAWIMDPAGHVWTVATRVEEPTEAERTARLANIHEKEP

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
7 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
67 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
68 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
69 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
70 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
71 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
72 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
75 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
76 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
77 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
78 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
79 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
80 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
81 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
83 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
84 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
85 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
86 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
87 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
88 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
89 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
90 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
91 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
92 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
93 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
94 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
95 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
96 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
97 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
98 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
99 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
100 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
101 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
102 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
103 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
104 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
105 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
106 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
107 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
110 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
111 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
112 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
113 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
114 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
115 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
116 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
117 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
118 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
119 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
120 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
121 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
122 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
123 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.56
Rhizosphere 98.88
Stem 0
Stem Tuber 0
Unclassified 20.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100000424 3300006844 Bacteria 41981
2 JGI25406J46586_10010657 3300003203 Bacteria 4068
3 Ga0070671_100042907 3300005355 Bacteria 3761
4 Ga0070709_10746868 3300005434 Unclassified 764
5 Ga0070713_100897512 3300005436 Bacteria 852
6 Ga0070713_101062717 3300005436 Unclassified 782
7 Ga0070705_100114924 3300005440 Bacteria 1727
8 Ga0070705_100302430 3300005440 Unclassified 1147
9 Ga0070694_100547712 3300005444 Bacteria 926
10 Ga0070708_100332658 3300005445 Bacteria 1431
11 Ga0070708_100695565 3300005445 Unclassified 957
12 Ga0070708_100838786 3300005445 Unclassified 864
13 Ga0070708_101269728 3300005445 Bacteria 688
14 Ga0070681_10058323 3300005458 Unclassified 3840
15 Ga0070706_100450226 3300005467 Bacteria 1198
16 Ga0070707_100301740 3300005468 Bacteria 1556
17 Ga0070707_100923027 3300005468 Bacteria 838
18 Ga0070698_100026781 3300005471 Bacteria 5997
19 Ga0070698_100103264 3300005471 Unclassified 2821
20 Ga0070698_100115305 3300005471 Bacteria 2651
21 Ga0070679_101693294 3300005530 Unclassified 580
22 Ga0070697_100582989 3300005536 Unclassified 982
23 Ga0070697_101142701 3300005536 Bacteria 693
24 Ga0070696_100030734 3300005546 Bacteria 3679
25 Ga0070665_100245091 3300005548 Bacteria 1792
26 Ga0070704_100363713 3300005549 Bacteria 1225
27 Ga0070704_101956833 3300005549 Unclassified 544
28 Ga0068855_100031533 3300005563 Bacteria 6329
29 Ga0070664_101605201 3300005564 Unclassified 616
30 Ga0068852_100894028 3300005616 Bacteria 905
31 Ga0068863_100008011 3300005841 Bacteria 10322
32 Ga0068863_100096881 3300005841 Bacteria 2801
33 Ga0081539_10000133 3300005985 Bacteria 173855
34 Ga0070715_10096798 3300006163 Bacteria 1369
35 Ga0097621_100154467 3300006237 Bacteria 1969
36 Ga0068871_101130943 3300006358 Unclassified 733
37 Ga0075428_100017855 3300006844 Bacteria 7839
38 Ga0075428_100033825 3300006844 Bacteria 5640
39 Ga0075430_100000780 3300006846 Bacteria 24644
40 Ga0075430_100008681 3300006846 Bacteria 8575
41 Ga0075430_100210062 3300006846 Bacteria 1615
42 Ga0075430_100454144 3300006846 Unclassified 1057
43 Ga0075431_100000488 3300006847 Bacteria 32895
44 Ga0075431_100063322 3300006847 Bacteria 3816
45 Ga0075431_100085050 3300006847 Bacteria 3265
46 Ga0075434_100001242 3300006871 Bacteria 21201
47 Ga0075429_100000735 3300006880 Bacteria 25664
48 Ga0075429_100264393 3300006880 Bacteria 1506
49 Ga0075436_100000721 3300006914 Bacteria 21881
50 Ga0075435_100000026 3300007076 Bacteria 87101
51 Ga0075435_100281412 3300007076 Bacteria 1420
52 Ga0099794_10209172 3300007265 Bacteria 1000
53 Ga0105240_10075553 3300009093 Bacteria 4156
54 Ga0111539_10002407 3300009094 Bacteria 24882
55 Ga0111539_10243529 3300009094 Bacteria 2094
56 Ga0114129_10000659 3300009147 Bacteria 43232
57 Ga0114129_10003829 3300009147 Bacteria 21200
58 Ga0114129_10032633 3300009147 Bacteria 7358
59 Ga0114129_11657786 3300009147 Bacteria 781
60 Ga0105242_12077571 3300009176 Unclassified 612
61 Ga0105248_10287359 3300009177 Bacteria 1852
62 Ga0105238_12376207 3300009551 Unclassified 565
63 Ga0105249_10034816 3300009553 Bacteria 4565
64 Ga0157369_10023531 3300013105 Bacteria 6861
65 Ga0157369_10040995 3300013105 Bacteria 5054
66 Ga0157374_10005705 3300013296 Bacteria 10500
67 Ga0157374_10052432 3300013296 Bacteria 3799
68 Ga0157374_10765473 3300013296 Unclassified 981
69 Ga0157378_10426925 3300013297 Bacteria 1311
70 Ga0157378_11740867 3300013297 Bacteria 671
71 Ga0163162_10535491 3300013306 Bacteria 1300
72 Ga0157372_10396628 3300013307 Bacteria 1608
73 Ga0157372_10842263 3300013307 Bacteria 1065
74 Ga0157375_10381995 3300013308 Bacteria 1575
75 Ga0163163_10669455 3300014325 Bacteria 1101
76 Ga0157376_10386978 3300014969 Bacteria 1349
77 Ga0207680_10347612 3300025903 Bacteria 1041
78 Ga0207685_10043398 3300025905 Unclassified 1694
79 Ga0207699_10486141 3300025906 Unclassified 890
80 Ga0207684_10285689 3300025910 Bacteria 1423
81 Ga0207684_10672999 3300025910 Bacteria 881
82 Ga0207707_10288876 3300025912 Bacteria 1419
83 Ga0207707_10468753 3300025912 Unclassified 1076
84 Ga0207695_10069702 3300025913 Bacteria 3597
85 Ga0207646_10217456 3300025922 Bacteria 1726
86 Ga0207646_10721402 3300025922 Unclassified 891
87 Ga0207700_10863674 3300025928 Unclassified 810
88 Ga0207700_11298163 3300025928 Unclassified 648
89 Ga0207644_10003609 3300025931 Bacteria 10025
90 Ga0207711_10595903 3300025941 Bacteria 1031
91 Ga0207667_10031377 3300025949 Bacteria 5736
92 Ga0207712_10160008 3300025961 Bacteria 1749
93 Ga0207677_10665673 3300026023 Bacteria 920
94 Ga0207703_10160860 3300026035 Bacteria 1967
95 Ga0207641_10005949 3300026088 Bacteria 10338
96 Ga0207641_10040845 3300026088 Bacteria 3886
97 Ga0207676_10026155 3300026095 Unclassified 4338
98 Ga0207428_10003771 3300027907 Bacteria 14550
99 Ga0207428_10030648 3300027907 Bacteria 4445
100 Ga0268266_10546651 3300028379 Bacteria 1109
101 Ga0307408_100002980 3300031548 Bacteria 11723
102 Ga0307408_100273255 3300031548 Bacteria 1404
103 Ga0307413_10829663 3300031824 Unclassified 779
104 Ga0307410_11536401 3300031852 Bacteria 587
105 Ga0307406_10015454 3300031901 Bacteria 4418
106 Ga0307407_10633126 3300031903 Bacteria 799
107 Ga0307412_10106207 3300031911 Bacteria 1996
108 Ga0307412_10240423 3300031911 Bacteria 1400
109 Ga0307409_100033746 3300031995 Bacteria 3728
110 Ga0307409_100540588 3300031995 Bacteria 1142
111 Ga0307416_100002307 3300032002 Bacteria 10897
112 Ga0307416_100082535 3300032002 Bacteria 2723
113 Ga0307411_10064414 3300032005 Bacteria 2454
114 Ga0307411_10378048 3300032005 Bacteria 1164
115 Ga0307415_100012802 3300032126 Unclassified 4867
116 Ga0307510_10367712 3300033180 Bacteria 885
117 Ga0373945_0006237 3300035116 Bacteria 3839
118 Ga0373946_0308324 3300035171 Unclassified 784
119 Ga0373927_0000306 3300035695 Bacteria 38554
120 Ga0373947_0000309 3300035725 Bacteria 27587
121 Ga0373937_0000254 3300036401 Bacteria 51805
122 Ga0373937_1181093 3300036401 Bacteria 714
123 Ga0373925_0000062 3300037068 Bacteria 114902
124 Ga0439441_039939 3300042001 Bacteria 937
125 Ga0439450_011611 3300042008 Unclassified 1729
126 Ga0451577_0036050 3300042876 Unclassified 4455
127 Ga0451577_0053460 3300042876 Bacteria 3606
128 Ga0453683_0008860 3300044673 Bacteria 6736
129 Ga0453683_0034794 3300044673 Bacteria 3175
130 Ga0453684_0515725 3300044712 Bacteria 1321
131 Ga0453684_1000217 3300044712 Bacteria 889
132 Ga0495592_0383569 3300046454 Bacteria 894
133 Ga0495651_0137770 3300046462 Bacteria 1774
134 Ga0495585_0007768 3300046492 Bacteria 6533
135 Ga0495594_0001013 3300046499 Bacteria 14654
136 Ga0495596_0078095 3300046500 Bacteria 1285
137 Ga0495606_0084947 3300046507 Bacteria 1959
138 Ga0495631_0074899 3300046518 Bacteria 1461
139 Ga0495644_0001022 3300046523 Bacteria 11661
140 Ga0495648_0194153 3300046524 Bacteria 1022
141 Ga0495642_0007292 3300046528 Bacteria 4245
142 Ga0495609_0021495 3300046538 Bacteria 2977
143 Ga0495633_0048914 3300046558 Bacteria 1996
144 Ga0495625_0126542 3300046660 Bacteria 1734
145 Ga0495659_0018524 3300046664 Bacteria 2321
146 Ga0495669_0052587 3300046684 Bacteria 1830
147 Ga0495669_0515758 3300046684 Unclassified 581
148 Ga0495670_0034398 3300046691 Bacteria 2524
149 Ga0495649_0086018 3300046694 Bacteria 1678
150 Ga0495636_0464281 3300047318 Bacteria 609
151 Ga0495680_0867226 3300047322 Bacteria 585
152 Ga0495677_0071793 3300047445 Bacteria 1291
153 Ga0496112_1222865 3300048915 Unclassified 668
154 Ga0501297_009819 3300049520 Bacteria 1075
155 Ga0501299_018032 3300049522 Unclassified 1265
156 Ga0501075_1008329 3300049591 Unclassified 633
157 Ga0501264_048673 3300049761 Bacteria 541
158 Ga0501272_035024 3300049769 Bacteria 652
159 Ga0501212_083067 3300049851 Unclassified 582
160 nmdc:mga05p37_13906_c1 3300050507 Bacteria 9645
161 nmdc:mga05p37_363_c1 3300050507 Bacteria 48819
162 nmdc:mga05p37_551113_c1 3300050507 Bacteria 1312
163 nmdc:mga09592_272265_c1 3300050508 Bacteria 1469
164 nmdc:mga09592_4801_c1 3300050508 Bacteria 10952
165 nmdc:mga0qj67_153284_c1 3300050509 Unclassified 1870
166 nmdc:mga0qj67_21636_c1 3300050509 Bacteria 4934
167 nmdc:mga0qj67_45484_c1 3300050509 Bacteria 3464
168 nmdc:mga0qj67_982283_c1 3300050509 Unclassified 663
169 nmdc:mga06r32_2730_c1 3300050510 Bacteria 15791
170 nmdc:mga06r32_34234_c1 3300050510 Bacteria 4789
171 nmdc:mga06r32_72168_c1 3300050510 Bacteria 3342
172 nmdc:mga08y16_10267_c1 3300050511 Bacteria 9831
173 nmdc:mga08y16_276259_c1 3300050511 Unclassified 1734
174 nmdc:mga0n895_916_c1 3300050512 Bacteria 21232
175 nmdc:mga0rr50_10_c1 3300050513 Bacteria 218067
176 nmdc:mga0rr50_1152826_c1 3300050513 Bacteria 659
177 nmdc:mga08x19_117_c1 3300050514 Bacteria 70876
178 Ga0590077_000471 3300059426 Bacteria 11314
179 Ga0075428_100000424
180 JGI25406J46586_10010657
181 Ga0070671_100042907
182 Ga0070709_10746868
183 Ga0070713_100897512
184 Ga0070713_101062717
185 Ga0070705_100114924
186 Ga0070705_100302430
187 Ga0070694_100547712
188 Ga0070708_100332658
189 Ga0070708_100695565
190 Ga0070708_100838786
191 Ga0070708_101269728
192 Ga0070681_10058323
193 Ga0070706_100450226
194 Ga0070707_100301740
195 Ga0070707_100923027
196 Ga0070698_100026781
197 Ga0070698_100103264
198 Ga0070698_100115305
199 Ga0070679_101693294
200 Ga0070697_100582989
201 Ga0070697_101142701
202 Ga0070696_100030734
203 Ga0070665_100245091
204 Ga0070704_100363713
205 Ga0070704_101956833
206 Ga0068855_100031533
207 Ga0070664_101605201
208 Ga0068852_100894028
209 Ga0068863_100008011
210 Ga0068863_100096881
211 Ga0081539_10000133
212 Ga0070715_10096798
213 Ga0097621_100154467
214 Ga0068871_101130943
215 Ga0075428_100017855
216 Ga0075428_100033825
217 Ga0075430_100000780
218 Ga0075430_100008681
219 Ga0075430_100210062
220 Ga0075430_100454144
221 Ga0075431_100000488
222 Ga0075431_100063322
223 Ga0075431_100085050
224 Ga0075434_100001242
225 Ga0075429_100000735
226 Ga0075429_100264393
227 Ga0075436_100000721
228 Ga0075435_100000026
229 Ga0075435_100281412
230 Ga0099794_10209172
231 Ga0105240_10075553
232 Ga0111539_10002407
233 Ga0111539_10243529
234 Ga0114129_10000659
235 Ga0114129_10003829
236 Ga0114129_10032633
237 Ga0114129_11657786
238 Ga0105242_12077571
239 Ga0105248_10287359
240 Ga0105238_12376207
241 Ga0105249_10034816
242 Ga0157369_10023531
243 Ga0157369_10040995
244 Ga0157374_10005705
245 Ga0157374_10052432
246 Ga0157374_10765473
247 Ga0157378_10426925
248 Ga0157378_11740867
249 Ga0163162_10535491
250 Ga0157372_10396628
251 Ga0157372_10842263
252 Ga0157375_10381995
253 Ga0163163_10669455
254 Ga0157376_10386978
255 Ga0207680_10347612
256 Ga0207685_10043398
257 Ga0207699_10486141
258 Ga0207684_10285689
259 Ga0207684_10672999
260 Ga0207707_10288876
261 Ga0207707_10468753
262 Ga0207695_10069702
263 Ga0207646_10217456
264 Ga0207646_10721402
265 Ga0207700_10863674
266 Ga0207700_11298163
267 Ga0207644_10003609
268 Ga0207711_10595903
269 Ga0207667_10031377
270 Ga0207712_10160008
271 Ga0207677_10665673
272 Ga0207703_10160860
273 Ga0207641_10005949
274 Ga0207641_10040845
275 Ga0207676_10026155
276 Ga0207428_10003771
277 Ga0207428_10030648
278 Ga0268266_10546651
279 Ga0307408_100002980
280 Ga0307408_100273255
281 Ga0307413_10829663
282 Ga0307410_11536401
283 Ga0307406_10015454
284 Ga0307407_10633126
285 Ga0307412_10106207
286 Ga0307412_10240423
287 Ga0307409_100033746
288 Ga0307409_100540588
289 Ga0307416_100002307
290 Ga0307416_100082535
291 Ga0307411_10064414
292 Ga0307411_10378048
293 Ga0307415_100012802
294 Ga0307510_10367712
295 Ga0373945_0006237
296 Ga0373946_0308324
297 Ga0373927_0000306
298 Ga0373947_0000309
299 Ga0373937_0000254
300 Ga0373937_1181093
301 Ga0373925_0000062
302 Ga0439441_039939
303 Ga0439450_011611
304 Ga0451577_0036050
305 Ga0451577_0053460
306 Ga0453683_0008860
307 Ga0453683_0034794
308 Ga0453684_0515725
309 Ga0453684_1000217
310 Ga0495592_0383569
311 Ga0495651_0137770
312 Ga0495585_0007768
313 Ga0495594_0001013
314 Ga0495596_0078095
315 Ga0495606_0084947
316 Ga0495631_0074899
317 Ga0495644_0001022
318 Ga0495648_0194153
319 Ga0495642_0007292
320 Ga0495609_0021495
321 Ga0495633_0048914
322 Ga0495625_0126542
323 Ga0495659_0018524
324 Ga0495669_0052587
325 Ga0495669_0515758
326 Ga0495670_0034398
327 Ga0495649_0086018
328 Ga0495636_0464281
329 Ga0495680_0867226
330 Ga0495677_0071793
331 Ga0496112_1222865
332 Ga0501297_009819
333 Ga0501299_018032
334 Ga0501075_1008329
335 Ga0501264_048673
336 Ga0501272_035024
337 Ga0501212_083067
338 nmdc:mga05p37_13906_c1
339 nmdc:mga05p37_363_c1
340 nmdc:mga05p37_551113_c1
341 nmdc:mga09592_272265_c1
342 nmdc:mga09592_4801_c1
343 nmdc:mga0qj67_153284_c1
344 nmdc:mga0qj67_21636_c1
345 nmdc:mga0qj67_45484_c1
346 nmdc:mga0qj67_982283_c1
347 nmdc:mga06r32_2730_c1
348 nmdc:mga06r32_34234_c1
349 nmdc:mga06r32_72168_c1
350 nmdc:mga08y16_10267_c1
351 nmdc:mga08y16_276259_c1
352 nmdc:mga0n895_916_c1
353 nmdc:mga0rr50_10_c1
354 nmdc:mga0rr50_1152826_c1
355 nmdc:mga08x19_117_c1
356 Ga0590077_000471

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

13

124

0.93

PF18029

Glyoxalase_6

Glyoxalase-like domain

13

125

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pav-assembly4.cif.gz_D structure of hypothetical protein sa1046 from s. aureus. 0.8099 10 132
3bqx-assembly1.cif.gz_A-2 high resolution crystal structure of a glyoxalase-related enzyme from fulvimarina pelagi 0.7931 9 133
1xy7-assembly1.cif.gz_B x-ray structure of gene product from arabidopsis thaliana at5g48480 0.7923 9 131
3itw-assembly1.cif.gz_A-2 crystal structure of tiox from micromonospora sp. ml1 0.7914 9 133
1fa5-assembly1.cif.gz_B crystal structure of the zn(ii)-bound glyoxalase i of escherichia coli 0.7881 9 132
ID Description Score Start End Superfamily
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9463 80 144 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8943 80 144 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.875 82 133 3.30.720.110
af_Q5VMX8_15_124_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8519 15 133 3.10.180.10
af_Q5VMX8_15_124_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8304 15 133 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A250J8E1-F1-model_v4 Glyoxalase 0.9943 81 150
AF-A0A6G2Q6E0-F1-model_v4 VOC family protein 0.9898 83 145
AF-A0A4Q3H228-F1-model_v4 VOC family protein 0.9692 11 136
AF-A0A562LAC1-F1-model_v4 PhnB protein 0.9673 85 154
AF-A0A4Q3H228-F1-model_v4 VOC family protein 0.9617 11 136

Map