F271713

General Info

Members Datasets Scaffolds Average Seq Length
178 143 356 216

Family's Representative Sequence

Representative Sequence 3300005840|Ga0068870_10392359|Ga0068870_103923591
Length 236
Sequence VCGLIERPSSSERVDERYSVLMRTIGFIGSGHIGSQVARLAVARGYAVVMSNSRGPETLAALVAELGPSARAATPAEAASAGDIVVVTVPLKNYRSVPVEPLAGKIVIDTNNYYPQRDGNIPELDSESTTTSELLQAHLPTSKVVKAFNHIYASQITTDGRPAGTKDRRALVIAGNDATAKATVTQLLDEFGYDTVDAGPLAESWRIQRDTPGYGPRRTADELKRDLAAAKRYLAT

Samples

Sample ID Description Type Environment
1 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
68 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
69 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
70 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
71 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
72 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
73 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
74 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
75 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
76 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
77 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
78 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
81 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
82 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
83 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
91 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
92 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
93 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
94 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
95 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
100 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
101 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
102 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
103 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
104 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
105 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
106 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
107 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
108 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
111 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
112 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
113 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
114 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
115 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
116 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
120 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
121 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
122 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
123 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
124 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
125 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
128 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
131 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
132 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
133 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
134 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
135 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
136 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
137 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
138 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
139 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
140 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
141 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
142 2643221630 Microbacterium sp. Root322 Isolate Unclassified
143 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.31
Metatranscriptomes 0
Isolates 1.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.81
Nodule 0
Rhizoplane 2.25
Rhizosphere 93.82
Stem 0
Stem Tuber 0
Unclassified 2.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068870_10392359 3300005840 Bacteria 901
2 Ga0065704_10476236 3300005289 Bacteria 685
3 Ga0065712_10002554 3300005290 Bacteria 6056
4 Ga0070689_100165983 3300005340 Bacteria 1787
5 Ga0070668_100284221 3300005347 Bacteria 1383
6 Ga0070674_100168976 3300005356 Bacteria 1666
7 Ga0070688_100234546 3300005365 Bacteria 1299
8 Ga0070700_100045629 3300005441 Bacteria 2704
9 Ga0070708_101043494 3300005445 Bacteria 766
10 Ga0070678_100106595 3300005456 Bacteria 2184
11 Ga0070678_100127517 3300005456 Bacteria 2017
12 Ga0070662_100617294 3300005457 Bacteria 913
13 Ga0070685_10077422 3300005466 Bacteria 1986
14 Ga0070672_100844163 3300005543 Bacteria 807
15 Ga0070686_100725329 3300005544 Bacteria 795
16 Ga0070695_100086950 3300005545 Bacteria 2078
17 Ga0070695_100177989 3300005545 Bacteria 1505
18 Ga0070665_100508684 3300005548 Bacteria 1216
19 Ga0070704_100384787 3300005549 Bacteria 1193
20 Ga0070702_100737902 3300005615 Bacteria 755
21 Ga0068852_100332485 3300005616 Bacteria 1479
22 Ga0068861_100016542 3300005719 Bacteria 5221
23 Ga0068861_100033701 3300005719 Bacteria 3781
24 Ga0068862_100572961 3300005844 Bacteria 1081
25 Ga0070712_100450220 3300006175 Bacteria 1072
26 Ga0097621_100358604 3300006237 Bacteria 1298
27 Ga0068871_100348666 3300006358 Bacteria 1309
28 Ga0075428_100037868 3300006844 Bacteria 5307
29 Ga0075428_100104100 3300006844 Bacteria 3095
30 Ga0075428_100424186 3300006844 Bacteria 1425
31 Ga0075428_100714808 3300006844 Bacteria 1067
32 Ga0075430_100024862 3300006846 Bacteria 5095
33 Ga0075430_100466884 3300006846 Bacteria 1042
34 Ga0075431_100013369 3300006847 Bacteria 8294
35 Ga0075431_100031010 3300006847 Bacteria 5506
36 Ga0075431_100932077 3300006847 Bacteria 837
37 Ga0075433_10200524 3300006852 Bacteria 1774
38 Ga0075429_100022744 3300006880 Bacteria 5435
39 Ga0068865_100576811 3300006881 Bacteria 948
40 Ga0075436_100189881 3300006914 Bacteria 1453
41 Ga0097620_100948055 3300006931 Bacteria 944
42 Ga0111539_10021902 3300009094 Bacteria 7856
43 Ga0114129_10039636 3300009147 Bacteria 6642
44 Ga0114129_10061403 3300009147 Bacteria 5252
45 Ga0114129_10061630 3300009147 Bacteria 5243
46 Ga0114129_10302262 3300009147 Bacteria 2132
47 Ga0105243_10140596 3300009148 Bacteria 2059
48 Ga0105242_10010050 3300009176 Bacteria 7246
49 Ga0105248_10079587 3300009177 Bacteria 3683
50 Ga0105248_10086141 3300009177 Bacteria 3535
51 Ga0105249_10008146 3300009553 Bacteria 9136
52 Ga0157374_10251253 3300013296 Unclassified 1740
53 Ga0163162_10048484 3300013306 Bacteria 4256
54 Ga0163162_10118855 3300013306 Bacteria 2745
55 Ga0157372_11114979 3300013307 Bacteria 913
56 Ga0157375_10812270 3300013308 Bacteria 1083
57 Ga0163163_10078910 3300014325 Bacteria 3290
58 Ga0157380_10050637 3300014326 Bacteria 3281
59 Ga0157380_10538760 3300014326 Bacteria 1142
60 Ga0157376_10331082 3300014969 Unclassified 1451
61 Ga0207697_10202208 3300025315 Bacteria 874
62 Ga0207642_10072463 3300025899 Bacteria 1644
63 Ga0207645_10061823 3300025907 Bacteria 2392
64 Ga0207643_10487630 3300025908 Bacteria 787
65 Ga0207681_10158239 3300025923 Bacteria 1704
66 Ga0207706_10810952 3300025933 Bacteria 795
67 Ga0207686_10040497 3300025934 Bacteria 2833
68 Ga0207669_10132698 3300025937 Bacteria 1714
69 Ga0207669_10187047 3300025937 Bacteria 1490
70 Ga0207669_10511192 3300025937 Bacteria 963
71 Ga0207704_10717001 3300025938 Bacteria 829
72 Ga0207665_10164099 3300025939 Bacteria 1600
73 Ga0207679_10351746 3300025945 Bacteria 1285
74 Ga0207667_10842015 3300025949 Bacteria 912
75 Ga0207668_10156268 3300025972 Bacteria 1772
76 Ga0207677_10726943 3300026023 Bacteria 883
77 Ga0207708_10186732 3300026075 Bacteria 1648
78 Ga0207641_10310753 3300026088 Bacteria 1492
79 Ga0207676_11232615 3300026095 Bacteria 742
80 Ga0207675_100002393 3300026118 Bacteria 18572
81 Ga0207683_10015564 3300026121 Bacteria 6474
82 Ga0207428_10006669 3300027907 Bacteria 10602
83 Ga0268266_10298999 3300028379 Bacteria 1501
84 Ga0265319_1000332 3300028563 Bacteria 34687
85 Ga0265318_10000774 3300028577 Bacteria 21210
86 Ga0265330_10000484 3300031235 Bacteria 26678
87 Ga0265330_10000641 3300031235 Bacteria 22492
88 Ga0265332_10000504 3300031238 Bacteria 26693
89 Ga0265328_10010788 3300031239 Bacteria 3669
90 Ga0265320_10000587 3300031240 Bacteria 27982
91 Ga0265320_10125503 3300031240 Bacteria 1168
92 Ga0265325_10075867 3300031241 Bacteria 1679
93 Ga0265329_10001304 3300031242 Bacteria 12116
94 Ga0265340_10005029 3300031247 Bacteria 7352
95 Ga0265340_10005361 3300031247 Bacteria 7122
96 Ga0265339_10005188 3300031249 Bacteria 8727
97 Ga0265331_10001185 3300031250 Bacteria 19739
98 Ga0265316_10003999 3300031344 Bacteria 14759
99 Ga0265316_10144970 3300031344 Bacteria 1781
100 Ga0307408_100005415 3300031548 Bacteria 8543
101 Ga0307408_100165965 3300031548 Bacteria 1758
102 Ga0265313_10000078 3300031595 Bacteria 95571
103 Ga0265314_10000967 3300031711 Bacteria 33769
104 Ga0265314_10066010 3300031711 Unclassified 2442
105 Ga0265342_10000690 3300031712 Bacteria 35337
106 Ga0307405_10437852 3300031731 Bacteria 1033
107 Ga0307410_10117784 3300031852 Bacteria 1932
108 Ga0307412_10136186 3300031911 Bacteria 1792
109 Ga0307409_100120620 3300031995 Bacteria 2220
110 Ga0307409_100289430 3300031995 Bacteria 1518
111 Ga0307416_100012190 3300032002 Bacteria 5776
112 Ga0307411_10047511 3300032005 Bacteria 2775
113 Ga0307411_10581648 3300032005 Bacteria 960
114 Ga0307415_100611080 3300032126 Bacteria 972
115 Ga0373941_0190108 3300035115 Bacteria 775
116 Ga0373943_0026673 3300035170 Bacteria 2708
117 Ga0373946_0040538 3300035171 Bacteria 1906
118 Ga0373935_0113005 3300035692 Bacteria 1805
119 Ga0373935_0181667 3300035692 Bacteria 1445
120 Ga0373927_0063980 3300035695 Bacteria 2379
121 Ga0373927_0081050 3300035695 Bacteria 2103
122 Ga0373947_0110257 3300035725 Bacteria 1738
123 Ga0373937_0682095 3300036401 Bacteria 974
124 Ga0373925_0333407 3300037068 Bacteria 1229
125 Ga0395901_0760053 3300038443 Bacteria 962
126 Ga0439431_0141276 3300041997 Bacteria 680
127 Ga0439445_0018009 3300042004 Bacteria 1750
128 Ga0450923_013705 3300042125 Bacteria 1493
129 Ga0439446_0010802 3300042156 Bacteria 2466
130 Ga0439446_0050594 3300042156 Bacteria 1240
131 Ga0439434_0047879 3300042435 Bacteria 1322
132 Ga0439434_0146916 3300042435 Bacteria 779
133 Ga0439435_0100150 3300042436 Bacteria 890
134 Ga0439464_0003239 3300042439 Bacteria 4096
135 Ga0439464_0156320 3300042439 Bacteria 715
136 Ga0453683_0065771 3300044673 Bacteria 2266
137 Ga0453684_0236235 3300044712 Bacteria 2107
138 Ga0466959_0241796 3300045049 Bacteria 1247
139 Ga0451576_0834945 3300045051 Bacteria 967
140 Ga0495633_0150771 3300046558 Unclassified 1074
141 Ga0495674_0748439 3300047319 Bacteria 764
142 Ga0496105_0391202 3300048908 Bacteria 1105
143 Ga0496110_0015361 3300048913 Bacteria 6371
144 Ga0496113_0094160 3300048916 Bacteria 2314
145 Ga0496115_0262615 3300048918 Bacteria 1420
146 Ga0501036_0021784 3300049572 Bacteria 5387
147 Ga0501038_0041842 3300049574 Bacteria 3994
148 Ga0501038_0352632 3300049574 Bacteria 1146
149 Ga0501042_0182126 3300049578 Bacteria 1516
150 Ga0501068_0398065 3300049584 Bacteria 888
151 Ga0501071_0017869 3300049587 Bacteria 4901
152 Ga0501073_0006460 3300049589 Bacteria 8722
153 Ga0501075_0058067 3300049591 Bacteria 2914
154 Ga0501075_0245320 3300049591 Bacteria 1365
155 Ga0501076_0023486 3300049592 Bacteria 4754
156 Ga0501077_0050850 3300049593 Bacteria 2634
157 Ga0501079_0094502 3300049741 Bacteria 2317
158 Ga0501080_0267925 3300049742 Bacteria 1555
159 Ga0501283_021223 3300049779 Bacteria 1041
160 Ga0501045_0064144 3300049824 Bacteria 2696
161 nmdc:mga05p37_21519_c1 3300050507 Bacteria 7812
162 nmdc:mga05p37_6069_c1 3300050507 Bacteria 14224
163 nmdc:mga09592_10140_c1 3300050508 Bacteria 7666
164 nmdc:mga0qj67_13804_c1 3300050509 Bacteria 6096
165 nmdc:mga06r32_444354_c1 3300050510 Bacteria 1277
166 nmdc:mga06r32_620073_c1 3300050510 Bacteria 1051
167 nmdc:mga06r32_7406_c1 3300050510 Bacteria 9871
168 Ga0500555_001892 3300053103 Bacteria 6215
169 Ga0500556_0075394 3300053104 Bacteria 1267
170 Ga0500568_0034115 3300053139 Bacteria 2083
171 Ga0500616_0004489 3300053153 Bacteria 9918
172 Ga0500645_001501 3300053730 Bacteria 11687
173 Ga0501084_0069151 3300054114 Bacteria 2956
174 Ga0590071_042017 3300059421 Bacteria 1101
175 Ga0501082_0135259 3300060353 Unclassified 2139
176 2643734605 2643221542 Bacteria 3563959
177 2644172730 2643221630 Bacteria 3601215
178 2852666183 2852663356 Bacteria 4090475
179 Ga0068870_10392359
180 Ga0065704_10476236
181 Ga0065712_10002554
182 Ga0070689_100165983
183 Ga0070668_100284221
184 Ga0070674_100168976
185 Ga0070688_100234546
186 Ga0070700_100045629
187 Ga0070708_101043494
188 Ga0070678_100106595
189 Ga0070678_100127517
190 Ga0070662_100617294
191 Ga0070685_10077422
192 Ga0070672_100844163
193 Ga0070686_100725329
194 Ga0070695_100086950
195 Ga0070695_100177989
196 Ga0070665_100508684
197 Ga0070704_100384787
198 Ga0070702_100737902
199 Ga0068852_100332485
200 Ga0068861_100016542
201 Ga0068861_100033701
202 Ga0068862_100572961
203 Ga0070712_100450220
204 Ga0097621_100358604
205 Ga0068871_100348666
206 Ga0075428_100037868
207 Ga0075428_100104100
208 Ga0075428_100424186
209 Ga0075428_100714808
210 Ga0075430_100024862
211 Ga0075430_100466884
212 Ga0075431_100013369
213 Ga0075431_100031010
214 Ga0075431_100932077
215 Ga0075433_10200524
216 Ga0075429_100022744
217 Ga0068865_100576811
218 Ga0075436_100189881
219 Ga0097620_100948055
220 Ga0111539_10021902
221 Ga0114129_10039636
222 Ga0114129_10061403
223 Ga0114129_10061630
224 Ga0114129_10302262
225 Ga0105243_10140596
226 Ga0105242_10010050
227 Ga0105248_10079587
228 Ga0105248_10086141
229 Ga0105249_10008146
230 Ga0157374_10251253
231 Ga0163162_10048484
232 Ga0163162_10118855
233 Ga0157372_11114979
234 Ga0157375_10812270
235 Ga0163163_10078910
236 Ga0157380_10050637
237 Ga0157380_10538760
238 Ga0157376_10331082
239 Ga0207697_10202208
240 Ga0207642_10072463
241 Ga0207645_10061823
242 Ga0207643_10487630
243 Ga0207681_10158239
244 Ga0207706_10810952
245 Ga0207686_10040497
246 Ga0207669_10132698
247 Ga0207669_10187047
248 Ga0207669_10511192
249 Ga0207704_10717001
250 Ga0207665_10164099
251 Ga0207679_10351746
252 Ga0207667_10842015
253 Ga0207668_10156268
254 Ga0207677_10726943
255 Ga0207708_10186732
256 Ga0207641_10310753
257 Ga0207676_11232615
258 Ga0207675_100002393
259 Ga0207683_10015564
260 Ga0207428_10006669
261 Ga0268266_10298999
262 Ga0265319_1000332
263 Ga0265318_10000774
264 Ga0265330_10000484
265 Ga0265330_10000641
266 Ga0265332_10000504
267 Ga0265328_10010788
268 Ga0265320_10000587
269 Ga0265320_10125503
270 Ga0265325_10075867
271 Ga0265329_10001304
272 Ga0265340_10005029
273 Ga0265340_10005361
274 Ga0265339_10005188
275 Ga0265331_10001185
276 Ga0265316_10003999
277 Ga0265316_10144970
278 Ga0307408_100005415
279 Ga0307408_100165965
280 Ga0265313_10000078
281 Ga0265314_10000967
282 Ga0265314_10066010
283 Ga0265342_10000690
284 Ga0307405_10437852
285 Ga0307410_10117784
286 Ga0307412_10136186
287 Ga0307409_100120620
288 Ga0307409_100289430
289 Ga0307416_100012190
290 Ga0307411_10047511
291 Ga0307411_10581648
292 Ga0307415_100611080
293 Ga0373941_0190108
294 Ga0373943_0026673
295 Ga0373946_0040538
296 Ga0373935_0113005
297 Ga0373935_0181667
298 Ga0373927_0063980
299 Ga0373927_0081050
300 Ga0373947_0110257
301 Ga0373937_0682095
302 Ga0373925_0333407
303 Ga0395901_0760053
304 Ga0439431_0141276
305 Ga0439445_0018009
306 Ga0450923_013705
307 Ga0439446_0010802
308 Ga0439446_0050594
309 Ga0439434_0047879
310 Ga0439434_0146916
311 Ga0439435_0100150
312 Ga0439464_0003239
313 Ga0439464_0156320
314 Ga0453683_0065771
315 Ga0453684_0236235
316 Ga0466959_0241796
317 Ga0451576_0834945
318 Ga0495633_0150771
319 Ga0495674_0748439
320 Ga0496105_0391202
321 Ga0496110_0015361
322 Ga0496113_0094160
323 Ga0496115_0262615
324 Ga0501036_0021784
325 Ga0501038_0041842
326 Ga0501038_0352632
327 Ga0501042_0182126
328 Ga0501068_0398065
329 Ga0501071_0017869
330 Ga0501073_0006460
331 Ga0501075_0058067
332 Ga0501075_0245320
333 Ga0501076_0023486
334 Ga0501077_0050850
335 Ga0501079_0094502
336 Ga0501080_0267925
337 Ga0501283_021223
338 Ga0501045_0064144
339 nmdc:mga05p37_21519_c1
340 nmdc:mga05p37_6069_c1
341 nmdc:mga09592_10140_c1
342 nmdc:mga0qj67_13804_c1
343 nmdc:mga06r32_444354_c1
344 nmdc:mga06r32_620073_c1
345 nmdc:mga06r32_7406_c1
346 Ga0500555_001892
347 Ga0500556_0075394
348 Ga0500568_0034115
349 Ga0500616_0004489
350 Ga0500645_001501
351 Ga0501084_0069151
352 Ga0590071_042017
353 Ga0501082_0135259
354 2643734605
355 2644172730
356 2852666183

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

24

113

0.97

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

8

96

0.84

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

24

130

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bul-assembly1.cif.gz_A structure of flavin-dependent brominase bmp2 triple mutant y302s f306v a345w 0.9527 4 29
4k2x-assembly1.cif.gz_A oxys anhydrotetracycline hydroxylase from streptomyces rimosus 0.9488 3 30
4k2x-assembly1.cif.gz_B oxys anhydrotetracycline hydroxylase from streptomyces rimosus 0.9487 3 30
6foy-assembly2.cif.gz_B the crystal structure of p.fluorescens kynurenine 3-monooxygenase (kmo) in complex with competitive inhibitor no. 9 0.9469 3 31
6ici-assembly1.cif.gz_A crystal structure of human mical3 0.9452 2 31
ID Description Score Start End Superfamily
af_P13033_4_399_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9554 4 31 3.50.50.60
af_Q0D7W4_71_358_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9516 3 29 3.50.50.60
6j0zC01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9475 4 31 3.50.50.60
af_Q46904_1_359_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9387 3 29 3.50.50.60
af_Q8VYV2_23_370_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.938 5 32 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A323V4D4-F1-model_v4 NADP oxidoreductase 0.9924 53 205
AF-A0A2M9VDH6-F1-model_v4 deleted 0.9891 81 206
AF-A7HE62-F1-model_v4 NADP oxidoreductase coenzyme F420-dependent 0.9851 1 204
AF-A0A4Q4D7D3-F1-model_v4 NADP oxidoreductase 0.9851 131 204
AF-A0A074UH61-F1-model_v4 deleted 0.9849 131 204

Map