F271697

General Info

Members Datasets Scaffolds Average Seq Length
178 131 178 106

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100058028|Ga0068857_1000580284
Length 126
Sequence MNQYEIAVLYHPDLEIDLEKGSGKVEKIFADNKAKVVNTDNWGKRKLAYPIKKNESAVYVFYIVEMPAENVRKVESVLNITDEVIRFLITRPDLKAIAKAEALKELKAKKAAERGESATEEKSEEE

Samples

Sample ID Description Type Environment
1 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
23 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
39 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
48 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
72 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
73 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
74 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
75 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
76 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
77 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
78 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
81 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
82 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
86 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
87 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
88 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
89 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
90 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
91 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
92 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
105 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
106 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
107 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
108 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
109 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
110 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
111 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
113 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
114 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
115 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
116 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
117 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
118 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
119 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
120 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
121 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
122 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
123 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
124 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
125 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
126 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
127 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
128 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
129 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
130 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.88
Metatranscriptomes 1.12
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.24
Nodule 0
Rhizoplane 1.69
Rhizosphere 85.96
Stem 0
Stem Tuber 0
Unclassified 1.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25405J52794_10024183 3300003911 Bacteria 1239
2 Ga0070658_10008093 3300005327 Bacteria 8456
3 Ga0070683_100652992 3300005329 Bacteria 1007
4 Ga0070690_100001023 3300005330 Bacteria 14301
5 Ga0070680_100086528 3300005336 Unclassified 2591
6 Ga0070680_101499251 3300005336 Unclassified 584
7 Ga0070682_100039677 3300005337 Bacteria 2894
8 Ga0070660_100001211 3300005339 Bacteria 17513
9 Ga0070689_100784024 3300005340 Bacteria 837
10 Ga0070659_100001474 3300005366 Bacteria 16940
11 Ga0070701_10503657 3300005438 Bacteria 787
12 Ga0070681_10363593 3300005458 Unclassified 1357
13 Ga0070681_10582166 3300005458 Unclassified 1033
14 Ga0068867_101178942 3300005459 Unclassified 702
15 Ga0070679_100010671 3300005530 Bacteria 8717
16 Ga0070679_100023461 3300005530 Bacteria 6040
17 Ga0070679_100478575 3300005530 Bacteria 1189
18 Ga0070679_101239846 3300005530 Bacteria 691
19 Ga0070684_100227319 3300005535 Unclassified 1703
20 Ga0070672_100002279 3300005543 Bacteria 12117
21 Ga0070686_100002098 3300005544 Bacteria 10998
22 Ga0068855_100001316 3300005563 Bacteria 30782
23 Ga0068855_100011009 3300005563 Bacteria 10918
24 Ga0068855_100204445 3300005563 Unclassified 2222
25 Ga0068855_101395025 3300005563 Bacteria 722
26 Ga0068857_100000001 3300005577 Bacteria 254081
27 Ga0068857_100058028 3300005577 Bacteria 3437
28 Ga0068859_100521769 3300005617 Unclassified 1283
29 Ga0068860_100216467 3300005843 Bacteria 1859
30 Ga0081455_10000020 3300005937 Bacteria 172997
31 Ga0075367_11078959 3300006178 Bacteria 513
32 Ga0075366_10000003 3300006195 Bacteria 114017
33 Ga0075366_10300466 3300006195 Unclassified 982
34 Ga0097621_100306384 3300006237 Bacteria 1404
35 Ga0097621_101566039 3300006237 Bacteria 626
36 Ga0075370_10004175 3300006353 Bacteria 6969
37 Ga0075370_10031847 3300006353 Unclassified 2945
38 Ga0068871_100414983 3300006358 Bacteria 1201
39 Ga0075430_100044535 3300006846 Bacteria 3751
40 Ga0068865_100060346 3300006881 Bacteria 2655
41 Ga0097620_100521791 3300006931 Unclassified 1283
42 Ga0105240_10000003 3300009093 Bacteria 1183681
43 Ga0105245_10000001 3300009098 Bacteria 939270
44 Ga0105245_10000127 3300009098 Bacteria 72844
45 Ga0105245_10701064 3300009098 Bacteria 1046
46 Ga0114129_13419037 3300009147 Unclassified 510
47 Ga0105243_10000001 3300009148 Bacteria 1156578
48 Ga0105241_11165622 3300009174 Unclassified 728
49 Ga0105241_11963413 3300009174 Bacteria 575
50 Ga0105242_10000001 3300009176 Bacteria 574039
51 Ga0105242_10421515 3300009176 Unclassified 1251
52 Ga0105237_10059034 3300009545 Bacteria 3839
53 Ga0105238_10064734 3300009551 Unclassified 3656
54 Ga0105238_10192231 3300009551 Unclassified 2017
55 Ga0105238_10894302 3300009551 Unclassified 906
56 Ga0105033_100961 3300009986 Bacteria 2297
57 Ga0105028_100381 3300009993 Bacteria 4757
58 Ga0105239_10033763 3300010375 Bacteria 5618
59 Ga0105239_10182627 3300010375 Bacteria 2347
60 Ga0105239_10828158 3300010375 Bacteria 1061
61 Ga0105246_10008863 3300011119 Bacteria 6191
62 Ga0157369_10012176 3300013105 Bacteria 9764
63 Ga0157374_10000598 3300013296 Bacteria 31965
64 Ga0157378_10567424 3300013297 Bacteria 1142
65 Ga0157375_10380671 3300013308 Bacteria 1578
66 Ga0163163_10834602 3300014325 Bacteria 985
67 Ga0157377_10135040 3300014745 Bacteria 1511
68 Ga0157377_10163894 3300014745 Bacteria 1385
69 Ga0206354_10665453 3300020081 Bacteria 659
70 Ga0207705_10006724 3300025909 Bacteria 8499
71 Ga0207707_10279946 3300025912 Unclassified 1445
72 Ga0207707_10422955 3300025912 Bacteria 1142
73 Ga0207695_10000005 3300025913 Bacteria 1196715
74 Ga0207660_10737078 3300025917 Unclassified 804
75 Ga0207657_10003393 3300025919 Bacteria 17022
76 Ga0207652_10007281 3300025921 Bacteria 8916
77 Ga0207652_10016363 3300025921 Bacteria 6055
78 Ga0207694_10040609 3300025924 Unclassified 3583
79 Ga0207694_10706913 3300025924 Unclassified 850
80 Ga0207687_10000001 3300025927 Bacteria 1130810
81 Ga0207687_10000004 3300025927 Bacteria 841177
82 Ga0207687_10000107 3300025927 Bacteria 60194
83 Ga0207690_10000566 3300025932 Bacteria 24162
84 Ga0207686_10000001 3300025934 Bacteria 1169580
85 Ga0207709_10000002 3300025935 Bacteria 1171536
86 Ga0207670_10119569 3300025936 Unclassified 1913
87 Ga0207704_10053700 3300025938 Unclassified 2451
88 Ga0207691_10121626 3300025940 Bacteria 2313
89 Ga0207711_10228449 3300025941 Bacteria 1704
90 Ga0207711_10283135 3300025941 Unclassified 1527
91 Ga0207667_10004009 3300025949 Bacteria 18097
92 Ga0207667_10010290 3300025949 Bacteria 10948
93 Ga0207667_10123625 3300025949 Bacteria 2666
94 Ga0207667_10329791 3300025949 Unclassified 1558
95 Ga0207667_10681194 3300025949 Bacteria 1032
96 Ga0207667_10694127 3300025949 Unclassified 1021
97 Ga0207712_11608025 3300025961 Unclassified 582
98 Ga0207648_10016255 3300026089 Bacteria 6808
99 Ga0207674_10000021 3300026116 Bacteria 161986
100 Ga0207674_10072925 3300026116 Unclassified 3448
101 Ga0207674_10460986 3300026116 Bacteria 1228
102 Ga0207674_11223599 3300026116 Bacteria 720
103 Ga0207428_10064712 3300027907 Unclassified 2886
104 Ga0268266_10025441 3300028379 Bacteria 5035
105 Ga0268264_11293903 3300028381 Unclassified 739
106 Ga0265326_10002455 3300028558 Bacteria 6251
107 Ga0265334_10004910 3300028573 Bacteria 5878
108 Ga0265334_10015736 3300028573 Bacteria 3139
109 Ga0265336_10003639 3300028666 Bacteria 6009
110 Ga0265338_10001797 3300028800 Bacteria 33738
111 Ga0265338_10017632 3300028800 Bacteria 7682
112 Ga0265339_10054277 3300031249 Bacteria 2177
113 Ga0265327_10000260 3300031251 Bacteria 104663
114 Ga0265327_10012933 3300031251 Bacteria 5585
115 Ga0265316_10189532 3300031344 Bacteria 1528
116 Ga0307516_10221104 3300031730 Unclassified 1603
117 Ga0307416_102152130 3300032002 Unclassified 659
118 Ga0395899_0003114 3300037312 Bacteria 13213
119 Ga0395900_0016132 3300037418 Bacteria 7609
120 Ga0395898_0023510 3300037466 Bacteria 6226
121 Ga0395905_0050956 3300037471 Bacteria 3877
122 Ga0395905_0754290 3300037471 Bacteria 876
123 Ga0395905_1260322 3300037471 Bacteria 643
124 Ga0395901_0016381 3300038443 Bacteria 7547
125 Ga0395901_0246512 3300038443 Bacteria 1862
126 Ga0395901_0310134 3300038443 Unclassified 1634
127 Ga0451791_0854992 3300041451 Unclassified 575
128 Ga0451835_0584693 3300041492 Unclassified 683
129 Ga0466967_0870420 3300045976 Bacteria 896
130 Ga0495588_0000594 3300046674 Bacteria 17175
131 Ga0495658_0154630 3300046683 Unclassified 1411
132 Ga0495649_0000209 3300046694 Bacteria 51400
133 Ga0496105_0274698 3300048908 Bacteria 1360
134 Ga0496105_0429384 3300048908 Bacteria 1045
135 Ga0501031_0000225 3300049568 Bacteria 32292
136 Ga0501032_0001619 3300049569 Bacteria 17969
137 Ga0501034_0025308 3300049571 Bacteria 6041
138 Ga0501034_0375309 3300049571 Unclassified 1348
139 Ga0501036_0001294 3300049572 Bacteria 19158
140 Ga0501037_0000146 3300049573 Bacteria 65527
141 Ga0501038_0000865 3300049574 Bacteria 26821
142 Ga0501039_0022150 3300049575 Bacteria 4877
143 Ga0501042_0014378 3300049578 Bacteria 5402
144 Ga0501043_0000139 3300049579 Bacteria 67517
145 Ga0501046_0000061 3300049580 Bacteria 120487
146 Ga0501047_0000764 3300049581 Bacteria 33686
147 Ga0501048_0000002 3300049582 Bacteria 108048
148 Ga0501069_0150011 3300049585 Bacteria 1339
149 Ga0501070_0002542 3300049586 Bacteria 15979
150 Ga0501073_0014832 3300049589 Bacteria 5656
151 Ga0501074_0472384 3300049590 Bacteria 889
152 Ga0501077_1077747 3300049593 Bacteria 517
153 Ga0501080_0303571 3300049742 Bacteria 1447
154 Ga0501083_0019578 3300049744 Unclassified 4714
155 Ga0501083_0020784 3300049744 Bacteria 4564
156 Ga0501083_0337114 3300049744 Bacteria 980
157 Ga0501035_0023323 3300049822 Bacteria 5676
158 Ga0501044_0005023 3300049823 Bacteria 14776
159 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
160 nmdc:mga06z11_936808_c1 3300050494 Bacteria 528
161 nmdc:mga07m45_3765_c1 3300050496 Bacteria 7337
162 nmdc:mga0qj67_38402_c1 3300050509 Bacteria 3756
163 nmdc:mga08y16_18194_c1 3300050511 Bacteria 7404
164 nmdc:mga0sz30_10_c2 3300050516 Bacteria 32861
165 Ga0500610_0000088 3300053079 Bacteria 27787
166 Ga0500643_002979 3300053087 Bacteria 8388
167 Ga0500644_0000248 3300053088 Bacteria 30614
168 Ga0500644_0161868 3300053088 Bacteria 905
169 Ga0500651_0653294 3300053093 Bacteria 566
170 Ga0500555_000002 3300053103 Bacteria 1314346
171 Ga0500614_000001 3300053123 Bacteria 1274484
172 Ga0500652_000012 3300053131 Bacteria 155076
173 Ga0500622_0430691 3300053156 Bacteria 529
174 Ga0500649_000006 3300053722 Bacteria 116211
175 Ga0500599_004706 3300053736 Bacteria 1696
176 Ga0501084_0792201 3300054114 Unclassified 798
177 Ga0587072_154229 3300059643 Bacteria 557
178 Ga0501082_0155571 3300060353 Unclassified 1986

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005329 Ga0070683_100652992 Ga0070683_1006529922 96
2 3300009176 Ga0105242_10421515 Ga0105242_104215152 98
3 3300025949 Ga0207667_10694127 Ga0207667_106941272 98
4 3300005535 Ga0070684_100227319 Ga0070684_1002273191 101
5 3300006237 Ga0097621_100306384 Ga0097621_1003063842 101
6 3300006358 Ga0068871_100414983 Ga0068871_1004149832 101
7 3300009147 Ga0114129_13419037 Ga0114129_134190371 101
8 3300009551 Ga0105238_10192231 Ga0105238_101922312 101
9 3300010375 Ga0105239_10828158 Ga0105239_108281581 101
10 3300014325 Ga0163163_10834602 Ga0163163_108346022 101
11 3300005340 Ga0070689_100784024 Ga0070689_1007840242 102
12 3300006237 Ga0097621_101566039 Ga0097621_1015660391 102
13 3300006881 Ga0068865_100060346 Ga0068865_1000603463 102
14 3300009093 Ga0105240_10000003 Ga0105240_1000000376 102
15 3300009098 Ga0105245_10000127 Ga0105245_1000012743 102
16 3300009148 Ga0105243_10000001 Ga0105243_100000011174 102
17 3300009176 Ga0105242_10000001 Ga0105242_1000000184 102
18 3300009545 Ga0105237_10059034 Ga0105237_100590347 102
19 3300010375 Ga0105239_10033763 Ga0105239_100337633 102
20 3300011119 Ga0105246_10008863 Ga0105246_100088635 102
21 3300013296 Ga0157374_10000598 Ga0157374_1000059812 102
22 3300013308 Ga0157375_10380671 Ga0157375_103806711 102
23 3300014745 Ga0157377_10135040 Ga0157377_101350403 102
24 3300020081 Ga0206354_10665453 Ga0206354_106654531 102
25 3300025913 Ga0207695_10000005 Ga0207695_1000000583 102
26 3300025927 Ga0207687_10000107 Ga0207687_1000010738 102
27 3300025934 Ga0207686_10000001 Ga0207686_100000011225 102
28 3300025935 Ga0207709_10000002 Ga0207709_1000000283 102
29 3300025938 Ga0207704_10053700 Ga0207704_100537003 102
30 3300025941 Ga0207711_10283135 Ga0207711_102831351 102
31 3300026089 Ga0207648_10016255 Ga0207648_100162555 102
32 3300026116 Ga0207674_10460986 Ga0207674_104609863 102
33 3300026116 Ga0207674_11223599 Ga0207674_112235991 102
34 3300028558 Ga0265326_10002455 Ga0265326_100024556 102
35 3300028573 Ga0265334_10004910 Ga0265334_100049106 102
36 3300028666 Ga0265336_10003639 Ga0265336_100036395 102
37 3300028800 Ga0265338_10001797 Ga0265338_100017976 102
38 3300028800 Ga0265338_10017632 Ga0265338_100176326 102
39 3300031249 Ga0265339_10054277 Ga0265339_100542775 102
40 3300031251 Ga0265327_10000260 Ga0265327_1000026083 102
41 3300031344 Ga0265316_10189532 Ga0265316_101895321 102
42 3300037471 Ga0395905_0754290 Ga0395905_0754290_242_622 102
43 3300041451 Ga0451791_0854992 Ga0451791_0854992_85_471 102
44 3300045976 Ga0466967_0870420 Ga0466967_0870420_348_722 102
45 3300049590 Ga0501074_0472384 Ga0501074_0472384_29_409 102
46 3300049593 Ga0501077_1077747 Ga0501077_1077747_105_485 102
47 3300003911 JGI25405J52794_10024183 JGI25405J52794_100241831 103
48 3300005327 Ga0070658_10008093 Ga0070658_100080936 103
49 3300005330 Ga0070690_100001023 Ga0070690_10000102317 103
50 3300005336 Ga0070680_100086528 Ga0070680_1000865283 103
51 3300005336 Ga0070680_101499251 Ga0070680_1014992511 103
52 3300005337 Ga0070682_100039677 Ga0070682_1000396771 103
53 3300005339 Ga0070660_100001211 Ga0070660_10000121117 103
54 3300005366 Ga0070659_100001474 Ga0070659_1000014743 103
55 3300005438 Ga0070701_10503657 Ga0070701_105036571 103
56 3300005458 Ga0070681_10363593 Ga0070681_103635933 103
57 3300005458 Ga0070681_10582166 Ga0070681_105821662 103
58 3300005459 Ga0068867_101178942 Ga0068867_1011789421 103
59 3300005530 Ga0070679_100010671 Ga0070679_1000106712 103
60 3300005530 Ga0070679_100023461 Ga0070679_10002346110 103
61 3300005530 Ga0070679_100478575 Ga0070679_1004785752 103
62 3300005530 Ga0070679_101239846 Ga0070679_1012398462 103
63 3300005543 Ga0070672_100002279 Ga0070672_1000022793 103
64 3300005544 Ga0070686_100002098 Ga0070686_10000209813 103
65 3300005563 Ga0068855_100001316 Ga0068855_10000131615 103
66 3300005563 Ga0068855_100011009 Ga0068855_1000110094 103
67 3300005563 Ga0068855_100204445 Ga0068855_1002044452 103
68 3300005563 Ga0068855_101395025 Ga0068855_1013950251 103
69 3300005577 Ga0068857_100000001 Ga0068857_10000000163 103
70 3300005577 Ga0068857_100058028 Ga0068857_1000580284 103
71 3300005617 Ga0068859_100521769 Ga0068859_1005217692 103
72 3300005843 Ga0068860_100216467 Ga0068860_1002164674 103
73 3300005937 Ga0081455_10000020 Ga0081455_10000020152 103
74 3300006178 Ga0075367_11078959 Ga0075367_110789591 103
75 3300006195 Ga0075366_10000003 Ga0075366_1000000377 103
76 3300006195 Ga0075366_10300466 Ga0075366_103004662 103
77 3300006353 Ga0075370_10004175 Ga0075370_100041752 103
78 3300006353 Ga0075370_10031847 Ga0075370_100318474 103
79 3300006846 Ga0075430_100044535 Ga0075430_1000445352 103
80 3300006931 Ga0097620_100521791 Ga0097620_1005217912 103
81 3300009098 Ga0105245_10000001 Ga0105245_10000001916 103
82 3300009098 Ga0105245_10701064 Ga0105245_107010641 103
83 3300009174 Ga0105241_11165622 Ga0105241_111656221 103
84 3300009174 Ga0105241_11963413 Ga0105241_119634131 103
85 3300009551 Ga0105238_10064734 Ga0105238_100647347 103
86 3300009551 Ga0105238_10894302 Ga0105238_108943021 103
87 3300009986 Ga0105033_100961 Ga0105033_1009613 103
88 3300009993 Ga0105028_100381 Ga0105028_1003812 103
89 3300010375 Ga0105239_10182627 Ga0105239_101826273 103
90 3300013105 Ga0157369_10012176 Ga0157369_1001217612 103
91 3300013297 Ga0157378_10567424 Ga0157378_105674242 103
92 3300014745 Ga0157377_10163894 Ga0157377_101638943 103
93 3300025909 Ga0207705_10006724 Ga0207705_100067246 103
94 3300025912 Ga0207707_10279946 Ga0207707_102799463 103
95 3300025912 Ga0207707_10422955 Ga0207707_104229552 103
96 3300025917 Ga0207660_10737078 Ga0207660_107370781 103
97 3300025919 Ga0207657_10003393 Ga0207657_100033934 103
98 3300025921 Ga0207652_10007281 Ga0207652_100072816 103
99 3300025921 Ga0207652_10016363 Ga0207652_1001636310 103
100 3300025924 Ga0207694_10040609 Ga0207694_100406092 103
101 3300025924 Ga0207694_10706913 Ga0207694_107069131 103
102 3300025927 Ga0207687_10000001 Ga0207687_10000001476 103
103 3300025927 Ga0207687_10000004 Ga0207687_10000004355 103
104 3300025932 Ga0207690_10000566 Ga0207690_1000056614 103
105 3300025936 Ga0207670_10119569 Ga0207670_101195693 103
106 3300025940 Ga0207691_10121626 Ga0207691_101216263 103
107 3300025941 Ga0207711_10228449 Ga0207711_102284493 103
108 3300025949 Ga0207667_10004009 Ga0207667_1000400915 103
109 3300025949 Ga0207667_10010290 Ga0207667_1001029011 103
110 3300025949 Ga0207667_10123625 Ga0207667_101236256 103
111 3300025949 Ga0207667_10329791 Ga0207667_103297912 103
112 3300025949 Ga0207667_10681194 Ga0207667_106811941 103
113 3300025961 Ga0207712_11608025 Ga0207712_116080251 103
114 3300026116 Ga0207674_10000021 Ga0207674_1000002160 103
115 3300026116 Ga0207674_10072925 Ga0207674_100729257 103
116 3300027907 Ga0207428_10064712 Ga0207428_100647122 103
117 3300028379 Ga0268266_10025441 Ga0268266_100254418 103
118 3300028381 Ga0268264_11293903 Ga0268264_112939032 103
119 3300028573 Ga0265334_10015736 Ga0265334_100157363 103
120 3300031251 Ga0265327_10012933 Ga0265327_100129334 103
121 3300031730 Ga0307516_10221104 Ga0307516_102211044 103
122 3300032002 Ga0307416_102152130 Ga0307416_1021521301 103
123 3300037312 Ga0395899_0003114 Ga0395899_0003114_1535_1924 103
124 3300037418 Ga0395900_0016132 Ga0395900_0016132_1535_1924 103
125 3300037466 Ga0395898_0023510 Ga0395898_0023510_5724_6113 103
126 3300037471 Ga0395905_0050956 Ga0395905_0050956_1310_1699 103
127 3300037471 Ga0395905_1260322 Ga0395905_1260322_70_450 103
128 3300038443 Ga0395901_0016381 Ga0395901_0016381_1349_1738 103
129 3300038443 Ga0395901_0246512 Ga0395901_0246512_694_1083 103
130 3300038443 Ga0395901_0310134 Ga0395901_0310134_36_416 103
131 3300041492 Ga0451835_0584693 Ga0451835_0584693_279_671 103
132 3300046674 Ga0495588_0000594 Ga0495588_0000594_2517_2897 103
133 3300046683 Ga0495658_0154630 Ga0495658_0154630_153_596 103
134 3300046694 Ga0495649_0000209 Ga0495649_0000209_4352_4735 103
135 3300048908 Ga0496105_0274698 Ga0496105_0274698_162_548 103
136 3300048908 Ga0496105_0429384 Ga0496105_0429384_160_561 103
137 3300049568 Ga0501031_0000225 Ga0501031_0000225_17729_18130 103
138 3300049569 Ga0501032_0001619 Ga0501032_0001619_8714_9115 103
139 3300049571 Ga0501034_0025308 Ga0501034_0025308_1283_1684 103
140 3300049571 Ga0501034_0375309 Ga0501034_0375309_673_1050 103
141 3300049572 Ga0501036_0001294 Ga0501036_0001294_13945_14346 103
142 3300049573 Ga0501037_0000146 Ga0501037_0000146_42361_42762 103
143 3300049574 Ga0501038_0000865 Ga0501038_0000865_11832_12233 103
144 3300049575 Ga0501039_0022150 Ga0501039_0022150_3621_4022 103
145 3300049578 Ga0501042_0014378 Ga0501042_0014378_868_1269 103
146 3300049579 Ga0501043_0000139 Ga0501043_0000139_41510_41911 103
147 3300049580 Ga0501046_0000061 Ga0501046_0000061_42421_42822 103
148 3300049581 Ga0501047_0000764 Ga0501047_0000764_7376_7777 103
149 3300049582 Ga0501048_0000002 Ga0501048_0000002_93587_93988 103
150 3300049585 Ga0501069_0150011 Ga0501069_0150011_100_501 103
151 3300049586 Ga0501070_0002542 Ga0501070_0002542_8175_8576 103
152 3300049589 Ga0501073_0014832 Ga0501073_0014832_3906_4307 103
153 3300049742 Ga0501080_0303571 Ga0501080_0303571_673_1074 103
154 3300049744 Ga0501083_0019578 Ga0501083_0019578_3992_4393 103
155 3300049744 Ga0501083_0020784 Ga0501083_0020784_1430_1819 103
156 3300049744 Ga0501083_0337114 Ga0501083_0337114_296_685 103
157 3300049822 Ga0501035_0023323 Ga0501035_0023323_1254_1655 103
158 3300049823 Ga0501044_0005023 Ga0501044_0005023_12524_12925 103
159 3300050493 nmdc:mga0k408_1_c1 nmdc:mga0k408_1_c1_60806_61195 103
160 3300050494 nmdc:mga06z11_936808_c1 nmdc:mga06z11_936808_c1_94_474 103
161 3300050496 nmdc:mga07m45_3765_c1 nmdc:mga07m45_3765_c1_924_1307 103
162 3300050509 nmdc:mga0qj67_38402_c1 nmdc:mga0qj67_38402_c1_2846_3229 103
163 3300050511 nmdc:mga08y16_18194_c1 nmdc:mga08y16_18194_c1_2395_2814 103
164 3300050516 nmdc:mga0sz30_10_c2 nmdc:mga0sz30_10_c2_22425_22814 103
165 3300053079 Ga0500610_0000088 Ga0500610_0000088_25930_26310 103
166 3300053087 Ga0500643_002979 Ga0500643_002979_594_974 103
167 3300053088 Ga0500644_0000248 Ga0500644_0000248_28497_28877 103
168 3300053088 Ga0500644_0161868 Ga0500644_0161868_436_819 103
169 3300053093 Ga0500651_0653294 Ga0500651_0653294_54_434 103
170 3300053103 Ga0500555_000002 Ga0500555_000002_1232098_1232478 103
171 3300053123 Ga0500614_000001 Ga0500614_000001_992156_992536 103
172 3300053131 Ga0500652_000012 Ga0500652_000012_49379_49759 103
173 3300053156 Ga0500622_0430691 Ga0500622_0430691_114_497 103
174 3300053722 Ga0500649_000006 Ga0500649_000006_85720_86100 103
175 3300053736 Ga0500599_004706 Ga0500599_004706_553_936 103
176 3300054114 Ga0501084_0792201 Ga0501084_0792201_320_715 103
177 3300059643 Ga0587072_154229 Ga0587072_154229_96_473 103
178 3300060353 Ga0501082_0155571 Ga0501082_0155571_1120_1521 103

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01250

Ribosomal_S6

Ribosomal protein S6

3

91

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bvz-assembly1.cif.gz_A mutant of the ribosomal protein s6 0.9471 1 93
2bxj-assembly2.cif.gz_B double mutant of the ribosomal protein s6 0.9457 1 93
1lou-assembly1.cif.gz_A ribosomal protein s6 0.9456 1 93
1cqn-assembly2.cif.gz_B protein aggregation and alzheimer's disease: crystallographic analysis of the phenomenon. engineered version of the ribosomal protein s6 used as a stable scaffold to study oligomerization. 0.9298 1 93
4v4w-assembly1.cif.gz_AF structure of a secm-stalled e. coli ribosome complex obtained by fitting atomic models for rna and protein components into cryo-em map emd-1143 0.9295 1 93
ID Description Score Start End Superfamily
af_B8JIY3_1_117_3.30.70.60 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.9346 1 93 3.30.70.60
af_F1M6D0_1_124_3.30.70.60 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.9225 1 95 3.30.70.60
2j5aA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.9209 2 93 3.30.70.60
2wrnF00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.9104 1 93 3.30.70.60
af_I1MGC0_138_240_3.30.70.60 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.9104 2 93 3.30.70.60
ID Description Score Start End GO Terms
AF-A0A519DUS8-F1-model_v4 Small ribosomal subunit protein bS6 (30S ribosomal protein S6) 0.9974 1 91 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0070181
GO:1990904
AF-A0A3S0U7B1-F1-model_v4 Small ribosomal subunit protein bS6 0.9924 1 92 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0070181
GO:1990904
AF-A0A258GH85-F1-model_v4 Small ribosomal subunit protein bS6 0.9869 2 102 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0070181
GO:1990904
AF-A0A7T9BHN9-F1-model_v4 deleted 0.9868 2 93
AF-A0A519DUS8-F1-model_v4 Small ribosomal subunit protein bS6 (30S ribosomal protein S6) 0.9865 1 91 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0070181
GO:1990904

Feature Viewer

pLDDT pTM Quality
86.02 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map