F271697
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 178 | 131 | 178 | 106 |
Family's Representative Sequence
| Representative Sequence | 3300005577|Ga0068857_100058028|Ga0068857_1000580284 |
| Length | 126 |
| Sequence | MNQYEIAVLYHPDLEIDLEKGSGKVEKIFADNKAKVVNTDNWGKRKLAYPIKKNESAVYVFYIVEMPAENVRKVESVLNITDEVIRFLITRPDLKAIAKAEALKELKAKKAAERGESATEEKSEEE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 13 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 18 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 19 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 20 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 21 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 22 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 23 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 24 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 25 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 26 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 27 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 28 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 29 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 39 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 40 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 49 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 69 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 72 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 73 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 74 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 75 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 76 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 77 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 78 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 79 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 80 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 81 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 82 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 83 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 84 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 85 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 86 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 87 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 88 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 92 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 93 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 94 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 95 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 96 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 97 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 98 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 99 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 100 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 101 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 102 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 103 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 104 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 105 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 106 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 107 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 108 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 109 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 110 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 111 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 112 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 113 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 114 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 115 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 116 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 117 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 118 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 119 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 120 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 121 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 122 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 123 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 124 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 125 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 126 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 127 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 128 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 129 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 130 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 131 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.88 |
| Metatranscriptomes | 1.12 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.24 |
| Nodule | 0 |
| Rhizoplane | 1.69 |
| Rhizosphere | 85.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25405J52794_10024183 | 3300003911 | Bacteria | 1239 |
| 2 | Ga0070658_10008093 | 3300005327 | Bacteria | 8456 |
| 3 | Ga0070683_100652992 | 3300005329 | Bacteria | 1007 |
| 4 | Ga0070690_100001023 | 3300005330 | Bacteria | 14301 |
| 5 | Ga0070680_100086528 | 3300005336 | Unclassified | 2591 |
| 6 | Ga0070680_101499251 | 3300005336 | Unclassified | 584 |
| 7 | Ga0070682_100039677 | 3300005337 | Bacteria | 2894 |
| 8 | Ga0070660_100001211 | 3300005339 | Bacteria | 17513 |
| 9 | Ga0070689_100784024 | 3300005340 | Bacteria | 837 |
| 10 | Ga0070659_100001474 | 3300005366 | Bacteria | 16940 |
| 11 | Ga0070701_10503657 | 3300005438 | Bacteria | 787 |
| 12 | Ga0070681_10363593 | 3300005458 | Unclassified | 1357 |
| 13 | Ga0070681_10582166 | 3300005458 | Unclassified | 1033 |
| 14 | Ga0068867_101178942 | 3300005459 | Unclassified | 702 |
| 15 | Ga0070679_100010671 | 3300005530 | Bacteria | 8717 |
| 16 | Ga0070679_100023461 | 3300005530 | Bacteria | 6040 |
| 17 | Ga0070679_100478575 | 3300005530 | Bacteria | 1189 |
| 18 | Ga0070679_101239846 | 3300005530 | Bacteria | 691 |
| 19 | Ga0070684_100227319 | 3300005535 | Unclassified | 1703 |
| 20 | Ga0070672_100002279 | 3300005543 | Bacteria | 12117 |
| 21 | Ga0070686_100002098 | 3300005544 | Bacteria | 10998 |
| 22 | Ga0068855_100001316 | 3300005563 | Bacteria | 30782 |
| 23 | Ga0068855_100011009 | 3300005563 | Bacteria | 10918 |
| 24 | Ga0068855_100204445 | 3300005563 | Unclassified | 2222 |
| 25 | Ga0068855_101395025 | 3300005563 | Bacteria | 722 |
| 26 | Ga0068857_100000001 | 3300005577 | Bacteria | 254081 |
| 27 | Ga0068857_100058028 | 3300005577 | Bacteria | 3437 |
| 28 | Ga0068859_100521769 | 3300005617 | Unclassified | 1283 |
| 29 | Ga0068860_100216467 | 3300005843 | Bacteria | 1859 |
| 30 | Ga0081455_10000020 | 3300005937 | Bacteria | 172997 |
| 31 | Ga0075367_11078959 | 3300006178 | Bacteria | 513 |
| 32 | Ga0075366_10000003 | 3300006195 | Bacteria | 114017 |
| 33 | Ga0075366_10300466 | 3300006195 | Unclassified | 982 |
| 34 | Ga0097621_100306384 | 3300006237 | Bacteria | 1404 |
| 35 | Ga0097621_101566039 | 3300006237 | Bacteria | 626 |
| 36 | Ga0075370_10004175 | 3300006353 | Bacteria | 6969 |
| 37 | Ga0075370_10031847 | 3300006353 | Unclassified | 2945 |
| 38 | Ga0068871_100414983 | 3300006358 | Bacteria | 1201 |
| 39 | Ga0075430_100044535 | 3300006846 | Bacteria | 3751 |
| 40 | Ga0068865_100060346 | 3300006881 | Bacteria | 2655 |
| 41 | Ga0097620_100521791 | 3300006931 | Unclassified | 1283 |
| 42 | Ga0105240_10000003 | 3300009093 | Bacteria | 1183681 |
| 43 | Ga0105245_10000001 | 3300009098 | Bacteria | 939270 |
| 44 | Ga0105245_10000127 | 3300009098 | Bacteria | 72844 |
| 45 | Ga0105245_10701064 | 3300009098 | Bacteria | 1046 |
| 46 | Ga0114129_13419037 | 3300009147 | Unclassified | 510 |
| 47 | Ga0105243_10000001 | 3300009148 | Bacteria | 1156578 |
| 48 | Ga0105241_11165622 | 3300009174 | Unclassified | 728 |
| 49 | Ga0105241_11963413 | 3300009174 | Bacteria | 575 |
| 50 | Ga0105242_10000001 | 3300009176 | Bacteria | 574039 |
| 51 | Ga0105242_10421515 | 3300009176 | Unclassified | 1251 |
| 52 | Ga0105237_10059034 | 3300009545 | Bacteria | 3839 |
| 53 | Ga0105238_10064734 | 3300009551 | Unclassified | 3656 |
| 54 | Ga0105238_10192231 | 3300009551 | Unclassified | 2017 |
| 55 | Ga0105238_10894302 | 3300009551 | Unclassified | 906 |
| 56 | Ga0105033_100961 | 3300009986 | Bacteria | 2297 |
| 57 | Ga0105028_100381 | 3300009993 | Bacteria | 4757 |
| 58 | Ga0105239_10033763 | 3300010375 | Bacteria | 5618 |
| 59 | Ga0105239_10182627 | 3300010375 | Bacteria | 2347 |
| 60 | Ga0105239_10828158 | 3300010375 | Bacteria | 1061 |
| 61 | Ga0105246_10008863 | 3300011119 | Bacteria | 6191 |
| 62 | Ga0157369_10012176 | 3300013105 | Bacteria | 9764 |
| 63 | Ga0157374_10000598 | 3300013296 | Bacteria | 31965 |
| 64 | Ga0157378_10567424 | 3300013297 | Bacteria | 1142 |
| 65 | Ga0157375_10380671 | 3300013308 | Bacteria | 1578 |
| 66 | Ga0163163_10834602 | 3300014325 | Bacteria | 985 |
| 67 | Ga0157377_10135040 | 3300014745 | Bacteria | 1511 |
| 68 | Ga0157377_10163894 | 3300014745 | Bacteria | 1385 |
| 69 | Ga0206354_10665453 | 3300020081 | Bacteria | 659 |
| 70 | Ga0207705_10006724 | 3300025909 | Bacteria | 8499 |
| 71 | Ga0207707_10279946 | 3300025912 | Unclassified | 1445 |
| 72 | Ga0207707_10422955 | 3300025912 | Bacteria | 1142 |
| 73 | Ga0207695_10000005 | 3300025913 | Bacteria | 1196715 |
| 74 | Ga0207660_10737078 | 3300025917 | Unclassified | 804 |
| 75 | Ga0207657_10003393 | 3300025919 | Bacteria | 17022 |
| 76 | Ga0207652_10007281 | 3300025921 | Bacteria | 8916 |
| 77 | Ga0207652_10016363 | 3300025921 | Bacteria | 6055 |
| 78 | Ga0207694_10040609 | 3300025924 | Unclassified | 3583 |
| 79 | Ga0207694_10706913 | 3300025924 | Unclassified | 850 |
| 80 | Ga0207687_10000001 | 3300025927 | Bacteria | 1130810 |
| 81 | Ga0207687_10000004 | 3300025927 | Bacteria | 841177 |
| 82 | Ga0207687_10000107 | 3300025927 | Bacteria | 60194 |
| 83 | Ga0207690_10000566 | 3300025932 | Bacteria | 24162 |
| 84 | Ga0207686_10000001 | 3300025934 | Bacteria | 1169580 |
| 85 | Ga0207709_10000002 | 3300025935 | Bacteria | 1171536 |
| 86 | Ga0207670_10119569 | 3300025936 | Unclassified | 1913 |
| 87 | Ga0207704_10053700 | 3300025938 | Unclassified | 2451 |
| 88 | Ga0207691_10121626 | 3300025940 | Bacteria | 2313 |
| 89 | Ga0207711_10228449 | 3300025941 | Bacteria | 1704 |
| 90 | Ga0207711_10283135 | 3300025941 | Unclassified | 1527 |
| 91 | Ga0207667_10004009 | 3300025949 | Bacteria | 18097 |
| 92 | Ga0207667_10010290 | 3300025949 | Bacteria | 10948 |
| 93 | Ga0207667_10123625 | 3300025949 | Bacteria | 2666 |
| 94 | Ga0207667_10329791 | 3300025949 | Unclassified | 1558 |
| 95 | Ga0207667_10681194 | 3300025949 | Bacteria | 1032 |
| 96 | Ga0207667_10694127 | 3300025949 | Unclassified | 1021 |
| 97 | Ga0207712_11608025 | 3300025961 | Unclassified | 582 |
| 98 | Ga0207648_10016255 | 3300026089 | Bacteria | 6808 |
| 99 | Ga0207674_10000021 | 3300026116 | Bacteria | 161986 |
| 100 | Ga0207674_10072925 | 3300026116 | Unclassified | 3448 |
| 101 | Ga0207674_10460986 | 3300026116 | Bacteria | 1228 |
| 102 | Ga0207674_11223599 | 3300026116 | Bacteria | 720 |
| 103 | Ga0207428_10064712 | 3300027907 | Unclassified | 2886 |
| 104 | Ga0268266_10025441 | 3300028379 | Bacteria | 5035 |
| 105 | Ga0268264_11293903 | 3300028381 | Unclassified | 739 |
| 106 | Ga0265326_10002455 | 3300028558 | Bacteria | 6251 |
| 107 | Ga0265334_10004910 | 3300028573 | Bacteria | 5878 |
| 108 | Ga0265334_10015736 | 3300028573 | Bacteria | 3139 |
| 109 | Ga0265336_10003639 | 3300028666 | Bacteria | 6009 |
| 110 | Ga0265338_10001797 | 3300028800 | Bacteria | 33738 |
| 111 | Ga0265338_10017632 | 3300028800 | Bacteria | 7682 |
| 112 | Ga0265339_10054277 | 3300031249 | Bacteria | 2177 |
| 113 | Ga0265327_10000260 | 3300031251 | Bacteria | 104663 |
| 114 | Ga0265327_10012933 | 3300031251 | Bacteria | 5585 |
| 115 | Ga0265316_10189532 | 3300031344 | Bacteria | 1528 |
| 116 | Ga0307516_10221104 | 3300031730 | Unclassified | 1603 |
| 117 | Ga0307416_102152130 | 3300032002 | Unclassified | 659 |
| 118 | Ga0395899_0003114 | 3300037312 | Bacteria | 13213 |
| 119 | Ga0395900_0016132 | 3300037418 | Bacteria | 7609 |
| 120 | Ga0395898_0023510 | 3300037466 | Bacteria | 6226 |
| 121 | Ga0395905_0050956 | 3300037471 | Bacteria | 3877 |
| 122 | Ga0395905_0754290 | 3300037471 | Bacteria | 876 |
| 123 | Ga0395905_1260322 | 3300037471 | Bacteria | 643 |
| 124 | Ga0395901_0016381 | 3300038443 | Bacteria | 7547 |
| 125 | Ga0395901_0246512 | 3300038443 | Bacteria | 1862 |
| 126 | Ga0395901_0310134 | 3300038443 | Unclassified | 1634 |
| 127 | Ga0451791_0854992 | 3300041451 | Unclassified | 575 |
| 128 | Ga0451835_0584693 | 3300041492 | Unclassified | 683 |
| 129 | Ga0466967_0870420 | 3300045976 | Bacteria | 896 |
| 130 | Ga0495588_0000594 | 3300046674 | Bacteria | 17175 |
| 131 | Ga0495658_0154630 | 3300046683 | Unclassified | 1411 |
| 132 | Ga0495649_0000209 | 3300046694 | Bacteria | 51400 |
| 133 | Ga0496105_0274698 | 3300048908 | Bacteria | 1360 |
| 134 | Ga0496105_0429384 | 3300048908 | Bacteria | 1045 |
| 135 | Ga0501031_0000225 | 3300049568 | Bacteria | 32292 |
| 136 | Ga0501032_0001619 | 3300049569 | Bacteria | 17969 |
| 137 | Ga0501034_0025308 | 3300049571 | Bacteria | 6041 |
| 138 | Ga0501034_0375309 | 3300049571 | Unclassified | 1348 |
| 139 | Ga0501036_0001294 | 3300049572 | Bacteria | 19158 |
| 140 | Ga0501037_0000146 | 3300049573 | Bacteria | 65527 |
| 141 | Ga0501038_0000865 | 3300049574 | Bacteria | 26821 |
| 142 | Ga0501039_0022150 | 3300049575 | Bacteria | 4877 |
| 143 | Ga0501042_0014378 | 3300049578 | Bacteria | 5402 |
| 144 | Ga0501043_0000139 | 3300049579 | Bacteria | 67517 |
| 145 | Ga0501046_0000061 | 3300049580 | Bacteria | 120487 |
| 146 | Ga0501047_0000764 | 3300049581 | Bacteria | 33686 |
| 147 | Ga0501048_0000002 | 3300049582 | Bacteria | 108048 |
| 148 | Ga0501069_0150011 | 3300049585 | Bacteria | 1339 |
| 149 | Ga0501070_0002542 | 3300049586 | Bacteria | 15979 |
| 150 | Ga0501073_0014832 | 3300049589 | Bacteria | 5656 |
| 151 | Ga0501074_0472384 | 3300049590 | Bacteria | 889 |
| 152 | Ga0501077_1077747 | 3300049593 | Bacteria | 517 |
| 153 | Ga0501080_0303571 | 3300049742 | Bacteria | 1447 |
| 154 | Ga0501083_0019578 | 3300049744 | Unclassified | 4714 |
| 155 | Ga0501083_0020784 | 3300049744 | Bacteria | 4564 |
| 156 | Ga0501083_0337114 | 3300049744 | Bacteria | 980 |
| 157 | Ga0501035_0023323 | 3300049822 | Bacteria | 5676 |
| 158 | Ga0501044_0005023 | 3300049823 | Bacteria | 14776 |
| 159 | nmdc:mga0k408_1_c1 | 3300050493 | Bacteria | 1089059 |
| 160 | nmdc:mga06z11_936808_c1 | 3300050494 | Bacteria | 528 |
| 161 | nmdc:mga07m45_3765_c1 | 3300050496 | Bacteria | 7337 |
| 162 | nmdc:mga0qj67_38402_c1 | 3300050509 | Bacteria | 3756 |
| 163 | nmdc:mga08y16_18194_c1 | 3300050511 | Bacteria | 7404 |
| 164 | nmdc:mga0sz30_10_c2 | 3300050516 | Bacteria | 32861 |
| 165 | Ga0500610_0000088 | 3300053079 | Bacteria | 27787 |
| 166 | Ga0500643_002979 | 3300053087 | Bacteria | 8388 |
| 167 | Ga0500644_0000248 | 3300053088 | Bacteria | 30614 |
| 168 | Ga0500644_0161868 | 3300053088 | Bacteria | 905 |
| 169 | Ga0500651_0653294 | 3300053093 | Bacteria | 566 |
| 170 | Ga0500555_000002 | 3300053103 | Bacteria | 1314346 |
| 171 | Ga0500614_000001 | 3300053123 | Bacteria | 1274484 |
| 172 | Ga0500652_000012 | 3300053131 | Bacteria | 155076 |
| 173 | Ga0500622_0430691 | 3300053156 | Bacteria | 529 |
| 174 | Ga0500649_000006 | 3300053722 | Bacteria | 116211 |
| 175 | Ga0500599_004706 | 3300053736 | Bacteria | 1696 |
| 176 | Ga0501084_0792201 | 3300054114 | Unclassified | 798 |
| 177 | Ga0587072_154229 | 3300059643 | Bacteria | 557 |
| 178 | Ga0501082_0155571 | 3300060353 | Unclassified | 1986 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005329 | Ga0070683_100652992 | Ga0070683_1006529922 | 96 |
| 2 | 3300009176 | Ga0105242_10421515 | Ga0105242_104215152 | 98 |
| 3 | 3300025949 | Ga0207667_10694127 | Ga0207667_106941272 | 98 |
| 4 | 3300005535 | Ga0070684_100227319 | Ga0070684_1002273191 | 101 |
| 5 | 3300006237 | Ga0097621_100306384 | Ga0097621_1003063842 | 101 |
| 6 | 3300006358 | Ga0068871_100414983 | Ga0068871_1004149832 | 101 |
| 7 | 3300009147 | Ga0114129_13419037 | Ga0114129_134190371 | 101 |
| 8 | 3300009551 | Ga0105238_10192231 | Ga0105238_101922312 | 101 |
| 9 | 3300010375 | Ga0105239_10828158 | Ga0105239_108281581 | 101 |
| 10 | 3300014325 | Ga0163163_10834602 | Ga0163163_108346022 | 101 |
| 11 | 3300005340 | Ga0070689_100784024 | Ga0070689_1007840242 | 102 |
| 12 | 3300006237 | Ga0097621_101566039 | Ga0097621_1015660391 | 102 |
| 13 | 3300006881 | Ga0068865_100060346 | Ga0068865_1000603463 | 102 |
| 14 | 3300009093 | Ga0105240_10000003 | Ga0105240_1000000376 | 102 |
| 15 | 3300009098 | Ga0105245_10000127 | Ga0105245_1000012743 | 102 |
| 16 | 3300009148 | Ga0105243_10000001 | Ga0105243_100000011174 | 102 |
| 17 | 3300009176 | Ga0105242_10000001 | Ga0105242_1000000184 | 102 |
| 18 | 3300009545 | Ga0105237_10059034 | Ga0105237_100590347 | 102 |
| 19 | 3300010375 | Ga0105239_10033763 | Ga0105239_100337633 | 102 |
| 20 | 3300011119 | Ga0105246_10008863 | Ga0105246_100088635 | 102 |
| 21 | 3300013296 | Ga0157374_10000598 | Ga0157374_1000059812 | 102 |
| 22 | 3300013308 | Ga0157375_10380671 | Ga0157375_103806711 | 102 |
| 23 | 3300014745 | Ga0157377_10135040 | Ga0157377_101350403 | 102 |
| 24 | 3300020081 | Ga0206354_10665453 | Ga0206354_106654531 | 102 |
| 25 | 3300025913 | Ga0207695_10000005 | Ga0207695_1000000583 | 102 |
| 26 | 3300025927 | Ga0207687_10000107 | Ga0207687_1000010738 | 102 |
| 27 | 3300025934 | Ga0207686_10000001 | Ga0207686_100000011225 | 102 |
| 28 | 3300025935 | Ga0207709_10000002 | Ga0207709_1000000283 | 102 |
| 29 | 3300025938 | Ga0207704_10053700 | Ga0207704_100537003 | 102 |
| 30 | 3300025941 | Ga0207711_10283135 | Ga0207711_102831351 | 102 |
| 31 | 3300026089 | Ga0207648_10016255 | Ga0207648_100162555 | 102 |
| 32 | 3300026116 | Ga0207674_10460986 | Ga0207674_104609863 | 102 |
| 33 | 3300026116 | Ga0207674_11223599 | Ga0207674_112235991 | 102 |
| 34 | 3300028558 | Ga0265326_10002455 | Ga0265326_100024556 | 102 |
| 35 | 3300028573 | Ga0265334_10004910 | Ga0265334_100049106 | 102 |
| 36 | 3300028666 | Ga0265336_10003639 | Ga0265336_100036395 | 102 |
| 37 | 3300028800 | Ga0265338_10001797 | Ga0265338_100017976 | 102 |
| 38 | 3300028800 | Ga0265338_10017632 | Ga0265338_100176326 | 102 |
| 39 | 3300031249 | Ga0265339_10054277 | Ga0265339_100542775 | 102 |
| 40 | 3300031251 | Ga0265327_10000260 | Ga0265327_1000026083 | 102 |
| 41 | 3300031344 | Ga0265316_10189532 | Ga0265316_101895321 | 102 |
| 42 | 3300037471 | Ga0395905_0754290 | Ga0395905_0754290_242_622 | 102 |
| 43 | 3300041451 | Ga0451791_0854992 | Ga0451791_0854992_85_471 | 102 |
| 44 | 3300045976 | Ga0466967_0870420 | Ga0466967_0870420_348_722 | 102 |
| 45 | 3300049590 | Ga0501074_0472384 | Ga0501074_0472384_29_409 | 102 |
| 46 | 3300049593 | Ga0501077_1077747 | Ga0501077_1077747_105_485 | 102 |
| 47 | 3300003911 | JGI25405J52794_10024183 | JGI25405J52794_100241831 | 103 |
| 48 | 3300005327 | Ga0070658_10008093 | Ga0070658_100080936 | 103 |
| 49 | 3300005330 | Ga0070690_100001023 | Ga0070690_10000102317 | 103 |
| 50 | 3300005336 | Ga0070680_100086528 | Ga0070680_1000865283 | 103 |
| 51 | 3300005336 | Ga0070680_101499251 | Ga0070680_1014992511 | 103 |
| 52 | 3300005337 | Ga0070682_100039677 | Ga0070682_1000396771 | 103 |
| 53 | 3300005339 | Ga0070660_100001211 | Ga0070660_10000121117 | 103 |
| 54 | 3300005366 | Ga0070659_100001474 | Ga0070659_1000014743 | 103 |
| 55 | 3300005438 | Ga0070701_10503657 | Ga0070701_105036571 | 103 |
| 56 | 3300005458 | Ga0070681_10363593 | Ga0070681_103635933 | 103 |
| 57 | 3300005458 | Ga0070681_10582166 | Ga0070681_105821662 | 103 |
| 58 | 3300005459 | Ga0068867_101178942 | Ga0068867_1011789421 | 103 |
| 59 | 3300005530 | Ga0070679_100010671 | Ga0070679_1000106712 | 103 |
| 60 | 3300005530 | Ga0070679_100023461 | Ga0070679_10002346110 | 103 |
| 61 | 3300005530 | Ga0070679_100478575 | Ga0070679_1004785752 | 103 |
| 62 | 3300005530 | Ga0070679_101239846 | Ga0070679_1012398462 | 103 |
| 63 | 3300005543 | Ga0070672_100002279 | Ga0070672_1000022793 | 103 |
| 64 | 3300005544 | Ga0070686_100002098 | Ga0070686_10000209813 | 103 |
| 65 | 3300005563 | Ga0068855_100001316 | Ga0068855_10000131615 | 103 |
| 66 | 3300005563 | Ga0068855_100011009 | Ga0068855_1000110094 | 103 |
| 67 | 3300005563 | Ga0068855_100204445 | Ga0068855_1002044452 | 103 |
| 68 | 3300005563 | Ga0068855_101395025 | Ga0068855_1013950251 | 103 |
| 69 | 3300005577 | Ga0068857_100000001 | Ga0068857_10000000163 | 103 |
| 70 | 3300005577 | Ga0068857_100058028 | Ga0068857_1000580284 | 103 |
| 71 | 3300005617 | Ga0068859_100521769 | Ga0068859_1005217692 | 103 |
| 72 | 3300005843 | Ga0068860_100216467 | Ga0068860_1002164674 | 103 |
| 73 | 3300005937 | Ga0081455_10000020 | Ga0081455_10000020152 | 103 |
| 74 | 3300006178 | Ga0075367_11078959 | Ga0075367_110789591 | 103 |
| 75 | 3300006195 | Ga0075366_10000003 | Ga0075366_1000000377 | 103 |
| 76 | 3300006195 | Ga0075366_10300466 | Ga0075366_103004662 | 103 |
| 77 | 3300006353 | Ga0075370_10004175 | Ga0075370_100041752 | 103 |
| 78 | 3300006353 | Ga0075370_10031847 | Ga0075370_100318474 | 103 |
| 79 | 3300006846 | Ga0075430_100044535 | Ga0075430_1000445352 | 103 |
| 80 | 3300006931 | Ga0097620_100521791 | Ga0097620_1005217912 | 103 |
| 81 | 3300009098 | Ga0105245_10000001 | Ga0105245_10000001916 | 103 |
| 82 | 3300009098 | Ga0105245_10701064 | Ga0105245_107010641 | 103 |
| 83 | 3300009174 | Ga0105241_11165622 | Ga0105241_111656221 | 103 |
| 84 | 3300009174 | Ga0105241_11963413 | Ga0105241_119634131 | 103 |
| 85 | 3300009551 | Ga0105238_10064734 | Ga0105238_100647347 | 103 |
| 86 | 3300009551 | Ga0105238_10894302 | Ga0105238_108943021 | 103 |
| 87 | 3300009986 | Ga0105033_100961 | Ga0105033_1009613 | 103 |
| 88 | 3300009993 | Ga0105028_100381 | Ga0105028_1003812 | 103 |
| 89 | 3300010375 | Ga0105239_10182627 | Ga0105239_101826273 | 103 |
| 90 | 3300013105 | Ga0157369_10012176 | Ga0157369_1001217612 | 103 |
| 91 | 3300013297 | Ga0157378_10567424 | Ga0157378_105674242 | 103 |
| 92 | 3300014745 | Ga0157377_10163894 | Ga0157377_101638943 | 103 |
| 93 | 3300025909 | Ga0207705_10006724 | Ga0207705_100067246 | 103 |
| 94 | 3300025912 | Ga0207707_10279946 | Ga0207707_102799463 | 103 |
| 95 | 3300025912 | Ga0207707_10422955 | Ga0207707_104229552 | 103 |
| 96 | 3300025917 | Ga0207660_10737078 | Ga0207660_107370781 | 103 |
| 97 | 3300025919 | Ga0207657_10003393 | Ga0207657_100033934 | 103 |
| 98 | 3300025921 | Ga0207652_10007281 | Ga0207652_100072816 | 103 |
| 99 | 3300025921 | Ga0207652_10016363 | Ga0207652_1001636310 | 103 |
| 100 | 3300025924 | Ga0207694_10040609 | Ga0207694_100406092 | 103 |
| 101 | 3300025924 | Ga0207694_10706913 | Ga0207694_107069131 | 103 |
| 102 | 3300025927 | Ga0207687_10000001 | Ga0207687_10000001476 | 103 |
| 103 | 3300025927 | Ga0207687_10000004 | Ga0207687_10000004355 | 103 |
| 104 | 3300025932 | Ga0207690_10000566 | Ga0207690_1000056614 | 103 |
| 105 | 3300025936 | Ga0207670_10119569 | Ga0207670_101195693 | 103 |
| 106 | 3300025940 | Ga0207691_10121626 | Ga0207691_101216263 | 103 |
| 107 | 3300025941 | Ga0207711_10228449 | Ga0207711_102284493 | 103 |
| 108 | 3300025949 | Ga0207667_10004009 | Ga0207667_1000400915 | 103 |
| 109 | 3300025949 | Ga0207667_10010290 | Ga0207667_1001029011 | 103 |
| 110 | 3300025949 | Ga0207667_10123625 | Ga0207667_101236256 | 103 |
| 111 | 3300025949 | Ga0207667_10329791 | Ga0207667_103297912 | 103 |
| 112 | 3300025949 | Ga0207667_10681194 | Ga0207667_106811941 | 103 |
| 113 | 3300025961 | Ga0207712_11608025 | Ga0207712_116080251 | 103 |
| 114 | 3300026116 | Ga0207674_10000021 | Ga0207674_1000002160 | 103 |
| 115 | 3300026116 | Ga0207674_10072925 | Ga0207674_100729257 | 103 |
| 116 | 3300027907 | Ga0207428_10064712 | Ga0207428_100647122 | 103 |
| 117 | 3300028379 | Ga0268266_10025441 | Ga0268266_100254418 | 103 |
| 118 | 3300028381 | Ga0268264_11293903 | Ga0268264_112939032 | 103 |
| 119 | 3300028573 | Ga0265334_10015736 | Ga0265334_100157363 | 103 |
| 120 | 3300031251 | Ga0265327_10012933 | Ga0265327_100129334 | 103 |
| 121 | 3300031730 | Ga0307516_10221104 | Ga0307516_102211044 | 103 |
| 122 | 3300032002 | Ga0307416_102152130 | Ga0307416_1021521301 | 103 |
| 123 | 3300037312 | Ga0395899_0003114 | Ga0395899_0003114_1535_1924 | 103 |
| 124 | 3300037418 | Ga0395900_0016132 | Ga0395900_0016132_1535_1924 | 103 |
| 125 | 3300037466 | Ga0395898_0023510 | Ga0395898_0023510_5724_6113 | 103 |
| 126 | 3300037471 | Ga0395905_0050956 | Ga0395905_0050956_1310_1699 | 103 |
| 127 | 3300037471 | Ga0395905_1260322 | Ga0395905_1260322_70_450 | 103 |
| 128 | 3300038443 | Ga0395901_0016381 | Ga0395901_0016381_1349_1738 | 103 |
| 129 | 3300038443 | Ga0395901_0246512 | Ga0395901_0246512_694_1083 | 103 |
| 130 | 3300038443 | Ga0395901_0310134 | Ga0395901_0310134_36_416 | 103 |
| 131 | 3300041492 | Ga0451835_0584693 | Ga0451835_0584693_279_671 | 103 |
| 132 | 3300046674 | Ga0495588_0000594 | Ga0495588_0000594_2517_2897 | 103 |
| 133 | 3300046683 | Ga0495658_0154630 | Ga0495658_0154630_153_596 | 103 |
| 134 | 3300046694 | Ga0495649_0000209 | Ga0495649_0000209_4352_4735 | 103 |
| 135 | 3300048908 | Ga0496105_0274698 | Ga0496105_0274698_162_548 | 103 |
| 136 | 3300048908 | Ga0496105_0429384 | Ga0496105_0429384_160_561 | 103 |
| 137 | 3300049568 | Ga0501031_0000225 | Ga0501031_0000225_17729_18130 | 103 |
| 138 | 3300049569 | Ga0501032_0001619 | Ga0501032_0001619_8714_9115 | 103 |
| 139 | 3300049571 | Ga0501034_0025308 | Ga0501034_0025308_1283_1684 | 103 |
| 140 | 3300049571 | Ga0501034_0375309 | Ga0501034_0375309_673_1050 | 103 |
| 141 | 3300049572 | Ga0501036_0001294 | Ga0501036_0001294_13945_14346 | 103 |
| 142 | 3300049573 | Ga0501037_0000146 | Ga0501037_0000146_42361_42762 | 103 |
| 143 | 3300049574 | Ga0501038_0000865 | Ga0501038_0000865_11832_12233 | 103 |
| 144 | 3300049575 | Ga0501039_0022150 | Ga0501039_0022150_3621_4022 | 103 |
| 145 | 3300049578 | Ga0501042_0014378 | Ga0501042_0014378_868_1269 | 103 |
| 146 | 3300049579 | Ga0501043_0000139 | Ga0501043_0000139_41510_41911 | 103 |
| 147 | 3300049580 | Ga0501046_0000061 | Ga0501046_0000061_42421_42822 | 103 |
| 148 | 3300049581 | Ga0501047_0000764 | Ga0501047_0000764_7376_7777 | 103 |
| 149 | 3300049582 | Ga0501048_0000002 | Ga0501048_0000002_93587_93988 | 103 |
| 150 | 3300049585 | Ga0501069_0150011 | Ga0501069_0150011_100_501 | 103 |
| 151 | 3300049586 | Ga0501070_0002542 | Ga0501070_0002542_8175_8576 | 103 |
| 152 | 3300049589 | Ga0501073_0014832 | Ga0501073_0014832_3906_4307 | 103 |
| 153 | 3300049742 | Ga0501080_0303571 | Ga0501080_0303571_673_1074 | 103 |
| 154 | 3300049744 | Ga0501083_0019578 | Ga0501083_0019578_3992_4393 | 103 |
| 155 | 3300049744 | Ga0501083_0020784 | Ga0501083_0020784_1430_1819 | 103 |
| 156 | 3300049744 | Ga0501083_0337114 | Ga0501083_0337114_296_685 | 103 |
| 157 | 3300049822 | Ga0501035_0023323 | Ga0501035_0023323_1254_1655 | 103 |
| 158 | 3300049823 | Ga0501044_0005023 | Ga0501044_0005023_12524_12925 | 103 |
| 159 | 3300050493 | nmdc:mga0k408_1_c1 | nmdc:mga0k408_1_c1_60806_61195 | 103 |
| 160 | 3300050494 | nmdc:mga06z11_936808_c1 | nmdc:mga06z11_936808_c1_94_474 | 103 |
| 161 | 3300050496 | nmdc:mga07m45_3765_c1 | nmdc:mga07m45_3765_c1_924_1307 | 103 |
| 162 | 3300050509 | nmdc:mga0qj67_38402_c1 | nmdc:mga0qj67_38402_c1_2846_3229 | 103 |
| 163 | 3300050511 | nmdc:mga08y16_18194_c1 | nmdc:mga08y16_18194_c1_2395_2814 | 103 |
| 164 | 3300050516 | nmdc:mga0sz30_10_c2 | nmdc:mga0sz30_10_c2_22425_22814 | 103 |
| 165 | 3300053079 | Ga0500610_0000088 | Ga0500610_0000088_25930_26310 | 103 |
| 166 | 3300053087 | Ga0500643_002979 | Ga0500643_002979_594_974 | 103 |
| 167 | 3300053088 | Ga0500644_0000248 | Ga0500644_0000248_28497_28877 | 103 |
| 168 | 3300053088 | Ga0500644_0161868 | Ga0500644_0161868_436_819 | 103 |
| 169 | 3300053093 | Ga0500651_0653294 | Ga0500651_0653294_54_434 | 103 |
| 170 | 3300053103 | Ga0500555_000002 | Ga0500555_000002_1232098_1232478 | 103 |
| 171 | 3300053123 | Ga0500614_000001 | Ga0500614_000001_992156_992536 | 103 |
| 172 | 3300053131 | Ga0500652_000012 | Ga0500652_000012_49379_49759 | 103 |
| 173 | 3300053156 | Ga0500622_0430691 | Ga0500622_0430691_114_497 | 103 |
| 174 | 3300053722 | Ga0500649_000006 | Ga0500649_000006_85720_86100 | 103 |
| 175 | 3300053736 | Ga0500599_004706 | Ga0500599_004706_553_936 | 103 |
| 176 | 3300054114 | Ga0501084_0792201 | Ga0501084_0792201_320_715 | 103 |
| 177 | 3300059643 | Ga0587072_154229 | Ga0587072_154229_96_473 | 103 |
| 178 | 3300060353 | Ga0501082_0155571 | Ga0501082_0155571_1120_1521 | 103 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2bvz-assembly1.cif.gz_A | mutant of the ribosomal protein s6 | 0.9471 | 1 | 93 |
| 2bxj-assembly2.cif.gz_B | double mutant of the ribosomal protein s6 | 0.9457 | 1 | 93 |
| 1lou-assembly1.cif.gz_A | ribosomal protein s6 | 0.9456 | 1 | 93 |
| 1cqn-assembly2.cif.gz_B | protein aggregation and alzheimer's disease: crystallographic analysis of the phenomenon. engineered version of the ribosomal protein s6 used as a stable scaffold to study oligomerization. | 0.9298 | 1 | 93 |
| 4v4w-assembly1.cif.gz_AF | structure of a secm-stalled e. coli ribosome complex obtained by fitting atomic models for rna and protein components into cryo-em map emd-1143 | 0.9295 | 1 | 93 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_B8JIY3_1_117_3.30.70.60 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B | 0.9346 | 1 | 93 | 3.30.70.60 |
| af_F1M6D0_1_124_3.30.70.60 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B | 0.9225 | 1 | 95 | 3.30.70.60 |
| 2j5aA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B | 0.9209 | 2 | 93 | 3.30.70.60 |
| 2wrnF00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B | 0.9104 | 1 | 93 | 3.30.70.60 |
| af_I1MGC0_138_240_3.30.70.60 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B | 0.9104 | 2 | 93 | 3.30.70.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519DUS8-F1-model_v4 | Small ribosomal subunit protein bS6 (30S ribosomal protein S6) | 0.9974 | 1 | 91 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:0070181 GO:1990904 |
| AF-A0A3S0U7B1-F1-model_v4 | Small ribosomal subunit protein bS6 | 0.9924 | 1 | 92 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:0070181 GO:1990904 |
| AF-A0A258GH85-F1-model_v4 | Small ribosomal subunit protein bS6 | 0.9869 | 2 | 102 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:0070181 GO:1990904 |
| AF-A0A7T9BHN9-F1-model_v4 | deleted | 0.9868 | 2 | 93 |
|
| AF-A0A519DUS8-F1-model_v4 | Small ribosomal subunit protein bS6 (30S ribosomal protein S6) | 0.9865 | 1 | 91 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:0070181 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar