F271102

General Info

Members Datasets Scaffolds Average Seq Length
177 130 350 352

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2884634485|2884634841
Length 390
Sequence SRPKVALITGITGQDGSYLAELLLEKGYIVHGIKRRASSFNTQRIDHLYQDLHESHVNFVLHYGDLTDSTNIIRIIQEVQPDEIYNLGAMSHVKVSFDSPEYVANVDAVGALRILEAVRILKLEKKTRVYQASTSELYGGMPENKNAAGFYDENSPFYPRSPYGVAKIYGFWITKNYREAYNMFACNGILFNHESPRRGETFVTRKITMAAAAIALGKQDCLYLGNLDAQRDWGHAKDYVKAMWLILQQEKPEDFVIATGQTTKVRDFVQMAFAYVGFTIRWEGSGADEVGILEAVDEQKYFEATGKEFRVRGSELATQNSELRTLNFEIGNLNIGSTLIKVDPTYFRPTEVDLLIGDPTKAKTQLGWEPEYDLQGLVEDMMRGDLEYFK

Samples

Sample ID Description Type Environment
1 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
8 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
9 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
10 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
11 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
12 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
13 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
14 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
15 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
16 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
17 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
18 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
19 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
20 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
21 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
22 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
23 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
24 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
25 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
35 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
38 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
39 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
40 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
41 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
42 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
43 3300031636 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
44 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
45 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
46 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
47 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
48 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
49 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
50 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
51 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
52 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
53 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
54 3300036242 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
55 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
56 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
57 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
58 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
59 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
60 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
61 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
62 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
63 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
64 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
65 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
66 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
67 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
68 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
69 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
70 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
71 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
72 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
73 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
74 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
75 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
76 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
77 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
78 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
79 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
80 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
81 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
82 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
83 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
84 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
85 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
86 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
88 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
89 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
90 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
91 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
92 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
93 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
94 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
95 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
96 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
97 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
98 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
99 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
100 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
101 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
102 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
103 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
104 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
105 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
106 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
107 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
108 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
109 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
110 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
111 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
112 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
113 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
114 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
115 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
116 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
117 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
118 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
119 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
120 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
121 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
122 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
123 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
124 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
125 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
126 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
127 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
128 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified
129 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
130 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.53
Metatranscriptomes 2.26
Isolates 19.21

Biome Distribution

Category Percentage (%)
Aerial Root 1.13
Bulb 0
Endosphere 3.39
Nodule 3.95
Rhizoplane 0
Rhizosphere 75.14
Stem 0
Stem Tuber 0
Unclassified 0.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1002696 3300002705 Bacteria 6215
2 rootH1_10000223 3300003316 Bacteria 10417
3 Ga0006562J51391_1006498 3300003578 Bacteria 16015
4 Ga0065714_10078468 3300005288 Bacteria 2596
5 Ga0070658_10002381 3300005327 Bacteria 15791
6 Ga0070658_10150656 3300005327 Bacteria 1947
7 Ga0070668_100046281 3300005347 Bacteria 3340
8 Ga0070665_100135661 3300005548 Bacteria 2463
9 Ga0068859_100000754 3300005617 Bacteria 32628
10 Ga0068863_100058011 3300005841 Bacteria 3664
11 Ga0068863_100102835 3300005841 Bacteria 2717
12 Ga0097620_100000754 3300006931 Bacteria 32628
13 Ga0079104_1000031 3300006946 Bacteria 204963
14 Ga0079104_1000118 3300006946 Bacteria 113197
15 Ga0105244_10000005 3300009036 Bacteria 481412
16 Ga0111539_10083841 3300009094 Bacteria 3748
17 Ga0105247_10023520 3300009101 Bacteria 3712
18 Ga0105248_10001013 3300009177 Bacteria 31022
19 Ga0157373_10000047 3300013100 Bacteria 110376
20 Ga0157373_10119295 3300013100 Bacteria 1854
21 Ga0157371_10000069 3300013102 Bacteria 165391
22 Ga0157371_10031796 3300013102 Bacteria 3800
23 Ga0157370_10000154 3300013104 Bacteria 84734
24 Ga0157370_10001430 3300013104 Bacteria 29613
25 Ga0157370_10002804 3300013104 Bacteria 20812
26 Ga0157370_10003406 3300013104 Bacteria 18685
27 Ga0157370_10160001 3300013104 Bacteria 2095
28 Ga0157369_10003837 3300013105 Bacteria 17855
29 Ga0163162_10000123 3300013306 Bacteria 68905
30 Ga0157380_10070070 3300014326 Bacteria 2832
31 Ga0182008_10000461 3300014497 Bacteria 31061
32 Ga0182006_1000357 3300015261 Bacteria 38142
33 Ga0163161_10000093 3300017792 Bacteria 90618
34 Ga0163161_10002146 3300017792 Bacteria 14224
35 Ga0207655_1000016 3300025728 Bacteria 551476
36 Ga0207710_10017432 3300025900 Bacteria 3046
37 Ga0207705_10004827 3300025909 Bacteria 10148
38 Ga0207705_10115111 3300025909 Bacteria 1990
39 Ga0207660_10068608 3300025917 Bacteria 2572
40 Ga0207711_10001155 3300025941 Bacteria 25166
41 Ga0207667_10024140 3300025949 Bacteria 6682
42 Ga0207668_10003344 3300025972 Bacteria 9395
43 Ga0207678_10068357 3300026067 Bacteria 3049
44 Ga0207641_10021084 3300026088 Bacteria 5356
45 Ga0207641_10126310 3300026088 Bacteria 2290
46 Ga0209281_1000062 3300027111 Bacteria 289797
47 Ga0209281_1000687 3300027111 Bacteria 34946
48 Ga0268266_10009465 3300028379 Bacteria 8575
49 Ga0268265_10000845 3300028380 Bacteria 28776
50 Ga0265322_10000943 3300028654 Bacteria 10150
51 Ga0265338_10000365 3300028800 Bacteria 81425
52 Ga0265324_10023730 3300029957 Bacteria 2183
53 Ga0265327_10001772 3300031251 Bacteria 25464
54 Ga0307408_100006122 3300031548 Bacteria 7993
55 Ga0307408_100123221 3300031548 Bacteria 2011
56 Ga0265313_10025353 3300031595 Bacteria 3144
57 Ga0310113_105977 3300031636 Unclassified 1388
58 Ga0265342_10109128 3300031712 Bacteria 1568
59 Ga0307405_10000011 3300031731 Bacteria 241071
60 Ga0307413_10195757 3300031824 Bacteria 1455
61 Ga0307410_10024822 3300031852 Bacteria 3751
62 Ga0307406_10000096 3300031901 Bacteria 50104
63 Ga0307407_10000143 3300031903 Bacteria 22122
64 Ga0307416_100000329 3300032002 Bacteria 24530
65 Ga0307414_10000903 3300032004 Bacteria 15224
66 Ga0307414_10001746 3300032004 Bacteria 11274
67 Ga0307414_10003291 3300032004 Bacteria 8613
68 Ga0307414_10007360 3300032004 Bacteria 6186
69 Ga0307414_10012555 3300032004 Bacteria 5013
70 Ga0307414_10016978 3300032004 Bacteria 4443
71 Ga0307414_10124253 3300032004 Bacteria 1990
72 Ga0307414_10137195 3300032004 Bacteria 1909
73 Ga0307411_10000014 3300032005 Bacteria 134682
74 Ga0307510_10009375 3300033180 Bacteria 11661
75 Ga0310104_03849 3300036242 Eukaryota 1294
76 Ga0310112_010670 3300036458 Eukaryota 1312
77 Ga0395899_0001296 3300037312 Bacteria 21589
78 Ga0395899_0032415 3300037312 Bacteria 3924
79 Ga0395899_0096705 3300037312 Bacteria 2135
80 Ga0395900_0248479 3300037418 Bacteria 1781
81 Ga0395898_0003369 3300037466 Bacteria 17901
82 Ga0395905_0012719 3300037471 Bacteria 8094
83 Ga0395901_0000997 3300038443 Bacteria 30602
84 Ga0395901_0005836 3300038443 Bacteria 12464
85 Ga0395901_0013033 3300038443 Bacteria 8437
86 Ga0395901_0150981 3300038443 Bacteria 2441
87 Ga0400486_08460 3300038742 Bacteria 7526
88 Ga0400483_105661 3300039062 Bacteria 3297
89 Ga0439466_0013314 3300041411 Bacteria 3012
90 Ga0439466_0013563 3300041411 Bacteria 2982
91 Ga0451577_0000103 3300042876 Bacteria 186594
92 Ga0451577_0001266 3300042876 Bacteria 34914
93 Ga0451577_0041360 3300042876 Bacteria 4137
94 Ga0453683_0291824 3300044673 Bacteria 1042
95 Ga0453684_0000038 3300044712 Bacteria 706970
96 Ga0453684_0003799 3300044712 Bacteria 33319
97 Ga0453684_0005569 3300044712 Bacteria 24851
98 Ga0453684_0026854 3300044712 Bacteria 8295
99 Ga0453684_0044918 3300044712 Bacteria 5901
100 Ga0453684_0055782 3300044712 Bacteria 5134
101 Ga0453684_0063430 3300044712 Bacteria 4727
102 Ga0466959_0000125 3300045049 Bacteria 49909
103 Ga0451576_0043380 3300045051 Bacteria 4746
104 Ga0495592_0000825 3300046454 Eukaryota 21526
105 Ga0495592_0002033 3300046454 Eukaryota 14243
106 Ga0495641_0000152 3300046461 Eukaryota 50671
107 Ga0495641_0001051 3300046461 Eukaryota 23718
108 Ga0495653_0039560 3300046463 Eukaryota 3693
109 Ga0495610_0000219 3300046512 Bacteria 61501
110 Ga0495610_0000371 3300046512 Bacteria 46658
111 Ga0495640_0005197 3300046533 Eukaryota 10345
112 Ga0495634_0000580 3300046642 Eukaryota 35588
113 Ga0495611_0058803 3300046648 Eukaryota 1744
114 Ga0495657_0000970 3300046675 Eukaryota 25342
115 Ga0495657_0095106 3300046675 Bacteria 1905
116 Ga0495646_0011607 3300046680 Eukaryota 5597
117 Ga0495624_0045225 3300046690 Eukaryota 2804
118 Ga0495672_0036057 3300047320 Bacteria 3040
119 Ga0495676_0001437 3300047321 Eukaryota 20543
120 Ga0495676_0192347 3300047321 Eukaryota 1422
121 Ga0495680_0000750 3300047322 Eukaryota 36364
122 Ga0495602_0002502 3300048088 Eukaryota 18727
123 Ga0495602_0012970 3300048088 Eukaryota 8530
124 Ga0496118_0037617 3300048921 Bacteria 3892
125 Ga0496125_0000018 3300048928 Bacteria 482390
126 Ga0496126_0000101 3300048929 Bacteria 201606
127 Ga0496126_0000534 3300048929 Bacteria 73515
128 Ga0501034_0154059 3300049571 Bacteria 2273
129 Ga0501238_000183 3300049671 Bacteria 9309
130 Ga0501249_000018 3300049679 Bacteria 113532
131 Ga0501249_000106 3300049679 Bacteria 25833
132 Ga0501257_010163 3300049686 Bacteria 2132
133 Ga0501259_013559 3300049688 Bacteria 1371
134 Ga0501264_000364 3300049761 Bacteria 7071
135 Ga0501266_000020 3300049763 Bacteria 101935
136 Ga0500641_0000016 3300053096 Bacteria 134532
137 Ga0500641_0000028 3300053096 Bacteria 105996
138 Ga0500641_0001850 3300053096 Bacteria 7507
139 Ga0500594_0013971 3300053118 Bacteria 1917
140 Ga0500568_0041795 3300053139 Bacteria 1841
141 Ga0500589_044210 3300053147 Bacteria 2076
142 2884634841 2884634485 Bacteria 3928637
143 2513233372 2513020052 Bacteria 5120511
144 2514592954 2513237351 Bacteria 6968952
145 2520879576 2519899754 Bacteria 5336938
146 2585424244 2582581873 Bacteria 3032664
147 2644009253 2643221600 Bacteria 5530138
148 2740002899 2739367857 Bacteria 5433684
149 2740007716 2739367858 Bacteria 5432813
150 2802654591 2802428842 Bacteria 4926114
151 2817413492 2816332280 Bacteria 5109718
152 2842727289 2842722452 Bacteria 6263924
153 2842914910 2842909656 Bacteria 6185908
154 2857617101 2857613821 Bacteria 4917088
155 2857619775 2857618242 Bacteria 5635925
156 2874171411 2874168670 Bacteria 8062617
157 2881364156 2881359912 Bacteria 4935907
158 2889293933 2889290771 Bacteria 5530962
159 2896344708 2896344016 Bacteria 3811746
160 2902049549 2902048731 Bacteria 4976191
161 2904447318 2904445276 Bacteria 5310396
162 2919194280 2919191525 Bacteria 5765973
163 2919686307 2919683626 Bacteria 5534354
164 2919692755 2919692658 Bacteria 5943958
165 2945998382 2945997725 Bacteria 6404843
166 2958514902 2958512119 Bacteria 4528530
167 2977244998 2977243572 Bacteria 4374394
168 2977272023 2977268062 Bacteria 5243061
169 2977865719 2977864932 Bacteria 7534097
170 2984574902 2984572630 Bacteria 4186940
171 2984608355 2984606641 Bacteria 4186971
172 3003237020 3003233435 Bacteria 4458031
173 8007375067 8007371054 Bacteria 4849201
174 8055423521 8055419101 Bacteria 5289643
175 8056440295 8056440228 Bacteria 4946504
176 JGI25156J39149_1002696
177 rootH1_10000223
178 Ga0006562J51391_1006498
179 Ga0065714_10078468
180 Ga0070658_10002381
181 Ga0070658_10150656
182 Ga0070668_100046281
183 Ga0070665_100135661
184 Ga0068859_100000754
185 Ga0068863_100058011
186 Ga0068863_100102835
187 Ga0097620_100000754
188 Ga0079104_1000031
189 Ga0079104_1000118
190 Ga0105244_10000005
191 Ga0111539_10083841
192 Ga0105247_10023520
193 Ga0105248_10001013
194 Ga0157373_10000047
195 Ga0157373_10119295
196 Ga0157371_10000069
197 Ga0157371_10031796
198 Ga0157370_10000154
199 Ga0157370_10001430
200 Ga0157370_10002804
201 Ga0157370_10003406
202 Ga0157370_10160001
203 Ga0157369_10003837
204 Ga0163162_10000123
205 Ga0157380_10070070
206 Ga0182008_10000461
207 Ga0182006_1000357
208 Ga0163161_10000093
209 Ga0163161_10002146
210 Ga0207655_1000016
211 Ga0207710_10017432
212 Ga0207705_10004827
213 Ga0207705_10115111
214 Ga0207660_10068608
215 Ga0207711_10001155
216 Ga0207667_10024140
217 Ga0207668_10003344
218 Ga0207678_10068357
219 Ga0207641_10021084
220 Ga0207641_10126310
221 Ga0209281_1000062
222 Ga0209281_1000687
223 Ga0268266_10009465
224 Ga0268265_10000845
225 Ga0265322_10000943
226 Ga0265338_10000365
227 Ga0265324_10023730
228 Ga0265327_10001772
229 Ga0307408_100006122
230 Ga0307408_100123221
231 Ga0265313_10025353
232 Ga0310113_105977
233 Ga0265342_10109128
234 Ga0307405_10000011
235 Ga0307413_10195757
236 Ga0307410_10024822
237 Ga0307406_10000096
238 Ga0307407_10000143
239 Ga0307416_100000329
240 Ga0307414_10000903
241 Ga0307414_10001746
242 Ga0307414_10003291
243 Ga0307414_10007360
244 Ga0307414_10012555
245 Ga0307414_10016978
246 Ga0307414_10124253
247 Ga0307414_10137195
248 Ga0307411_10000014
249 Ga0307510_10009375
250 Ga0310104_03849
251 Ga0310112_010670
252 Ga0395899_0001296
253 Ga0395899_0032415
254 Ga0395899_0096705
255 Ga0395900_0248479
256 Ga0395898_0003369
257 Ga0395905_0012719
258 Ga0395901_0000997
259 Ga0395901_0005836
260 Ga0395901_0013033
261 Ga0395901_0150981
262 Ga0400486_08460
263 Ga0400483_105661
264 Ga0439466_0013314
265 Ga0439466_0013563
266 Ga0451577_0000103
267 Ga0451577_0001266
268 Ga0451577_0041360
269 Ga0453683_0291824
270 Ga0453684_0000038
271 Ga0453684_0003799
272 Ga0453684_0005569
273 Ga0453684_0026854
274 Ga0453684_0044918
275 Ga0453684_0055782
276 Ga0453684_0063430
277 Ga0466959_0000125
278 Ga0451576_0043380
279 Ga0495592_0000825
280 Ga0495592_0002033
281 Ga0495641_0000152
282 Ga0495641_0001051
283 Ga0495653_0039560
284 Ga0495610_0000219
285 Ga0495610_0000371
286 Ga0495640_0005197
287 Ga0495634_0000580
288 Ga0495611_0058803
289 Ga0495657_0000970
290 Ga0495657_0095106
291 Ga0495646_0011607
292 Ga0495624_0045225
293 Ga0495672_0036057
294 Ga0495676_0001437
295 Ga0495676_0192347
296 Ga0495680_0000750
297 Ga0495602_0002502
298 Ga0495602_0012970
299 Ga0496118_0037617
300 Ga0496125_0000018
301 Ga0496126_0000101
302 Ga0496126_0000534
303 Ga0501034_0154059
304 Ga0501238_000183
305 Ga0501249_000018
306 Ga0501249_000106
307 Ga0501257_010163
308 Ga0501259_013559
309 Ga0501264_000364
310 Ga0501266_000020
311 Ga0500641_0000016
312 Ga0500641_0000028
313 Ga0500641_0001850
314 Ga0500594_0013971
315 Ga0500568_0041795
316 Ga0500589_044210
317 2884634841
318 2513233372
319 2514592954
320 2520879576
321 2585424244
322 2644009253
323 2740002899
324 2740007716
325 2802654591
326 2817413492
327 2842727289
328 2842914910
329 2857617101
330 2857619775
331 2874171411
332 2881364156
333 2889293933
334 2896344708
335 2902049549
336 2904447318
337 2919194280
338 2919686307
339 2919692755
340 2945998382
341 2958514902
342 2977244998
343 2977272023
344 2977865719
345 2984574902
346 2984608355
347 3003237020
348 8007375067
349 8055423521
350 8056440295

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

6

258

0.96

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

7

329

0.93

PF04321

RmlD_sub_bind

RmlD substrate binding domain

4

212

0.89

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

6

132

0.84

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

292

381

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gpj-assembly1.cif.gz_A crystal structure of human gdp-d-mannose 4,6-dehydratase in complex with gdp-4f-man 0.986 10 355
6gpl-assembly1.cif.gz_B crystal structure of human gdp-d-mannose 4,6-dehydratase in complex with gdp-4k6d-man 0.9849 10 355
6q94-assembly3.cif.gz_H-2 crystal structure of human gdp-d-mannose 4,6-dehydratase (s156d) in complex with gdp-man 0.9821 10 355
6gpk-assembly1.cif.gz_C crystal structure of human gdp-d-mannose 4,6-dehydratase (e157q) in complex with gdp-man 0.979 10 355
6q94-assembly1.cif.gz_B-3 crystal structure of human gdp-d-mannose 4,6-dehydratase (s156d) in complex with gdp-man 0.9778 10 355
ID Description Score Start End Superfamily
af_Q4D941_50_182_3.90.25.10 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9934 200 330 3.90.25.10
af_P0AC88_3_270_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9907 10 275 3.40.50.720
af_P0AC88_3_270_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9797 10 275 3.40.50.720
af_F1QPT3_45_368_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9765 33 347 3.40.50.720
af_Q4CM81_7_150_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9714 10 157 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A287VKI9-F1-model_v4 deleted 0.9959 166 275
AF-A0A625RB69-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) 0.9953 65 199 GO:0008446
GO:0042351
AF-A0A730K5U1-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) 0.9943 192 294 GO:0008446
GO:0042351
AF-A0A382CEB6-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) 0.9941 68 236 GO:0008446
GO:0042351
AF-A0A497EDG3-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) 0.9938 90 349 GO:0008446
GO:0042351

Map