F270578

General Info

Members Datasets Scaffolds Average Seq Length
177 135 164 213

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0000792|Ga0395900_0000792_14677_15408
Length 243
Sequence LSIFQGQWFRRHFDQGFPARYCSFEQEEGREVSEEIIQGSDQWKALRLGKVTASRVADVIAKTKSGYSASRANYMAQLIAERLTGTVAESYTNAAMQHGTETEPEARDAYCFYQGVTVEQVAFVPHPKIDQAGCSPDGLVGTDGLVEIKAPNTATHLETLLGQGVPIKYEAQMQFQMSCTGRQWCDFVSYDPRMPENMRLFIKRVPRNDAFIAEIEKEIAAFLLEMAVKLSQLTTLYGEKEAA

Samples

Sample ID Description Type Environment
1 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
2 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
3 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
4 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
5 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
6 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
7 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
8 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
9 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
10 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
11 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
73 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
74 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
75 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
76 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
77 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
78 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
79 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
80 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
81 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
90 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
91 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
92 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
93 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
94 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
95 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
96 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
97 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
98 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
99 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
100 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
101 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
102 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
103 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
104 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
105 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
106 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
107 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
108 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
109 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
110 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
111 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
112 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
113 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
120 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
121 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
122 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
123 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
124 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
127 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
128 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
129 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
130 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
131 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
132 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
133 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
134 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
135 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.66
Metatranscriptomes 0
Isolates 7.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.52
Nodule 10.73
Rhizoplane 1.69
Rhizosphere 79.1
Stem 0
Stem Tuber 0
Unclassified 3.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10312338 3300003320 Unclassified 1471
2 rootL2_10061741 3300003322 Viruses 9023
3 rootH1_10273622 3300003323 Bacteria 4452
4 Ga0070680_100069771 3300005336 Viruses 2886
5 Ga0070691_10000022 3300005341 Bacteria 45190
6 Ga0070687_100127781 3300005343 Bacteria 1463
7 Ga0070713_100613986 3300005436 Bacteria 1034
8 Ga0070679_100060389 3300005530 Viruses 3778
9 Ga0070704_100007151 3300005549 Bacteria 6630
10 Ga0068855_100047864 3300005563 Bacteria 5050
11 Ga0068855_100121419 3300005563 Bacteria 2990
12 Ga0068855_100475321 3300005563 Bacteria 1361
13 Ga0068857_100005208 3300005577 Bacteria 11066
14 Ga0068857_100679861 3300005577 Viruses 977
15 Ga0068854_100318050 3300005578 Bacteria 1264
16 Ga0068856_100012262 3300005614 Bacteria 8301
17 Ga0068856_100139657 3300005614 Bacteria 2430
18 Ga0068852_100037498 3300005616 Viruses 4064
19 Ga0068852_100084274 3300005616 Bacteria 2828
20 Ga0068863_100186798 3300005841 Bacteria 1991
21 Ga0068858_100005484 3300005842 Bacteria 12421
22 Ga0068862_100058891 3300005844 Bacteria 3296
23 Ga0068862_100204334 3300005844 Bacteria 1782
24 Ga0070717_10010547 3300006028 Bacteria 6981
25 Ga0097621_100009170 3300006237 Bacteria 7172
26 Ga0097621_100054695 3300006237 Bacteria 3256
27 Ga0068871_100077751 3300006358 Bacteria 2743
28 Ga0068871_100148720 3300006358 Bacteria 1996
29 Ga0097620_100000373 3300006931 Bacteria 44683
30 Ga0079104_1011238 3300006946 Bacteria 2890
31 Ga0105240_11240641 3300009093 Unclassified 788
32 Ga0105245_10010285 3300009098 Bacteria 8146
33 Ga0105242_10087892 3300009176 Viruses 2610
34 Ga0105248_10281488 3300009177 Bacteria 1872
35 Ga0105248_10282317 3300009177 Bacteria 1869
36 Ga0105237_10122509 3300009545 Viruses 2594
37 Ga0105238_10226277 3300009551 Viruses 1847
38 Ga0105238_10597035 3300009551 Viruses 1112
39 Ga0105147_101534 3300009982 Viruses 1892
40 Ga0105246_10131382 3300011119 Bacteria 1871
41 Ga0157370_10246142 3300013104 Viruses 1654
42 Ga0157378_10240947 3300013297 Bacteria 1727
43 Ga0163162_10044179 3300013306 Bacteria 4462
44 Ga0157380_10002255 3300014326 Bacteria 12962
45 Ga0157380_10049225 3300014326 Bacteria 3323
46 Ga0157376_10000689 3300014969 Bacteria 21819
47 Ga0163161_10005890 3300017792 Bacteria 8502
48 Ga0214544_1001101 3300021320 Bacteria 54573
49 Ga0213876_10000139 3300021384 Bacteria 79650
50 Ga0209050_1031072 3300025298 Bacteria 1672
51 Ga0209051_1002247 3300025303 Bacteria 14191
52 Ga0207707_10193444 3300025912 Bacteria 1774
53 Ga0207671_10262995 3300025914 Unclassified 1358
54 Ga0207660_10136854 3300025917 Bacteria 1870
55 Ga0207662_10091475 3300025918 Bacteria 1872
56 Ga0207652_10046019 3300025921 Viruses 3721
57 Ga0207652_10126652 3300025921 Bacteria 2275
58 Ga0207694_10007094 3300025924 Bacteria 8512
59 Ga0207694_10048224 3300025924 Bacteria 3295
60 Ga0207687_10014360 3300025927 Bacteria 5181
61 Ga0207686_10303516 3300025934 Bacteria 1186
62 Ga0207709_10020002 3300025935 Viruses 3772
63 Ga0207667_10004525 3300025949 Bacteria 17031
64 Ga0207667_10066820 3300025949 Bacteria 3747
65 Ga0207640_10228377 3300025981 Bacteria 1430
66 Ga0207703_10003362 3300026035 Bacteria 13440
67 Ga0207708_10079710 3300026075 Bacteria 2516
68 Ga0207702_10002680 3300026078 Bacteria 16713
69 Ga0207702_10143896 3300026078 Bacteria 2161
70 Ga0207641_10327888 3300026088 Bacteria 1453
71 Ga0207674_10005171 3300026116 Bacteria 15550
72 Ga0207674_10357595 3300026116 Viruses 1411
73 Ga0207683_10830246 3300026121 Bacteria 858
74 Ga0207698_10036751 3300026142 Bacteria 3599
75 Ga0207698_10309549 3300026142 Unclassified 1474
76 Ga0209281_1002528 3300027111 Bacteria 7194
77 Ga0268265_10204544 3300028380 Bacteria 1715
78 Ga0268265_10914934 3300028380 Bacteria 862
79 Ga0265326_10000108 3300028558 Bacteria 42070
80 Ga0265334_10009073 3300028573 Bacteria 4216
81 Ga0265338_10001236 3300028800 Bacteria 42106
82 Ga0265338_10120981 3300028800 Bacteria 2087
83 Ga0265327_10056796 3300031251 Bacteria 2015
84 Ga0307516_10014660 3300031730 Bacteria 8281
85 Ga0315914_1000381 3300031967 Bacteria 53028
86 Ga0315913_1000080 3300033430 Bacteria 53028
87 Ga0315915_1000191 3300033464 Bacteria 53028
88 Ga0373934_0085450 3300035086 Viruses 1269
89 Ga0373932_0000027 3300035112 Bacteria 41292
90 Ga0373937_0438129 3300036401 Viruses 1240
91 Ga0395899_0000531 3300037312 Bacteria 41752
92 Ga0395899_0006178 3300037312 Bacteria 9281
93 Ga0395899_0040860 3300037312 Viruses 3467
94 Ga0395899_0082054 3300037312 Bacteria 2345
95 Ga0395900_0000708 3300037418 Bacteria 44416
96 Ga0395900_0000792 3300037418 Bacteria 41752
97 Ga0395900_0001179 3300037418 Bacteria 32476
98 Ga0395900_0002020 3300037418 Bacteria 22819
99 Ga0395900_0013066 3300037418 Bacteria 8483
100 Ga0395900_0013570 3300037418 Bacteria 8323
101 Ga0395900_0083288 3300037418 Viruses 3286
102 Ga0395900_0189603 3300037418 Bacteria 2086
103 Ga0395900_0191204 3300037418 Bacteria 2076
104 Ga0395898_0001021 3300037466 Bacteria 43637
105 Ga0395898_0001100 3300037466 Bacteria 41752
106 Ga0395898_0003723 3300037466 Bacteria 16909
107 Ga0395898_0008196 3300037466 Bacteria 11053
108 Ga0395898_0054993 3300037466 Bacteria 3882
109 Ga0395898_0110205 3300037466 Viruses 2639
110 Ga0395898_0233148 3300037466 Bacteria 1755
111 Ga0395898_0621387 3300037466 Bacteria 1023
112 Ga0395905_0000784 3300037471 Bacteria 41752
113 Ga0395901_0000606 3300038443 Bacteria 41752
114 Ga0395901_0005118 3300038443 Bacteria 13240
115 Ga0395901_0013110 3300038443 Bacteria 8413
116 Ga0395901_0053648 3300038443 Bacteria 4189
117 Ga0436365_0464075 3300039437 Bacteria 37609
118 Ga0451849_0984794 3300041505 Bacteria 672
119 Ga0453684_0326890 3300044712 Viruses 1735
120 Ga0466957_0128828 3300044842 Bacteria 1619
121 Ga0495651_0147353 3300046462 Viruses 1700
122 Ga0495653_0405930 3300046463 Bacteria 865
123 Ga0495607_0000302 3300046501 Bacteria 51609
124 Ga0495606_0046449 3300046507 Bacteria 2870
125 Ga0495608_0035804 3300046511 Bacteria 3345
126 Ga0495618_0272575 3300046514 Viruses 1057
127 Ga0495628_0451681 3300046516 Viruses 933
128 Ga0495630_0018194 3300046517 Bacteria 5160
129 Ga0495609_0000550 3300046538 Bacteria 29688
130 Ga0495588_0046387 3300046674 Bacteria 2229
131 Ga0495657_0422647 3300046675 Unclassified 782
132 Ga0495669_0185830 3300046684 Bacteria 991
133 Ga0495613_0048773 3300046689 Unclassified 3127
134 Ga0495604_0449082 3300047317 Viruses 842
135 Ga0495674_0074099 3300047319 Viruses 2933
136 Ga0495680_0272588 3300047322 Viruses 1194
137 Ga0495675_0040570 3300047444 Viruses 2966
138 Ga0495675_0342012 3300047444 Viruses 881
139 Ga0495684_0139479 3300047471 Bacteria 1818
140 Ga0496104_0762967 3300048907 Bacteria 874
141 Ga0496105_0000137 3300048908 Bacteria 49046
142 Ga0496115_0031988 3300048918 Viruses 4149
143 Ga0501032_0003198 3300049569 Bacteria 12609
144 Ga0501033_0008348 3300049570 Bacteria 8020
145 Ga0501036_0027153 3300049572 Bacteria 4837
146 Ga0501037_0021360 3300049573 Bacteria 4782
147 Ga0501038_0614302 3300049574 Unclassified 821
148 Ga0501047_0762454 3300049581 Viruses 783
149 Ga0501067_0000134 3300049583 Bacteria 40540
150 Ga0501068_0000980 3300049584 Bacteria 15007
151 Ga0501073_0000003 3300049589 Bacteria 294975
152 Ga0501077_0000001 3300049593 Bacteria 270489
153 Ga0501080_0004514 3300049742 Bacteria 12410
154 Ga0501035_0000468 3300049822 Bacteria 45254
155 Ga0501044_0003199 3300049823 Bacteria 18460
156 Ga0495595_0045147 3300053084 Bacteria 2026
157 Ga0495619_0272300 3300053085 Bacteria 1173
158 Ga0500554_000010 3300053102 Bacteria 43509
159 Ga0500585_045155 3300053144 Bacteria 1564
160 Ga0500603_000048 3300053150 Bacteria 29163
161 Ga0500638_000035 3300053162 Bacteria 43365
162 Ga0500637_0000100 3300053178 Bacteria 31119
163 Ga0500584_000010 3300053726 Bacteria 42797
164 Ga0501082_0401717 3300060353 Viruses 1196

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005549 Ga0070704_100007151 Ga0070704_1000071513 175
2 3300005844 Ga0068862_100204334 Ga0068862_1002043342 184
3 3300028380 Ga0268265_10204544 Ga0268265_102045443 184
4 3300005436 Ga0070713_100613986 Ga0070713_1006139862 188
5 3300005841 Ga0068863_100186798 Ga0068863_1001867983 189
6 3300041505 Ga0451849_0984794 Ga0451849_0984794_17_616 191
7 3300053726 Ga0500584_000010 Ga0500584_000010_1798_2433 191
8 3300049581 Ga0501047_0762454 Ga0501047_0762454_18_635 193
9 3300005336 Ga0070680_100069771 Ga0070680_1000697716 196
10 3300009982 Ga0105147_101534 Ga0105147_1015343 196
11 3300025917 Ga0207660_10136854 Ga0207660_101368542 196
12 3300037418 Ga0395900_0000708 Ga0395900_0000708_14028_14657 196
13 3300037466 Ga0395898_0001021 Ga0395898_0001021_2345_2974 196
14 3300037466 Ga0395898_0621387 Ga0395898_0621387_313_942 196
15 3300048908 Ga0496105_0000137 Ga0496105_0000137_44891_45529 196
16 3300048918 Ga0496115_0031988 Ga0496115_0031988_1988_2623 196
17 3300049569 Ga0501032_0003198 Ga0501032_0003198_9872_10495 196
18 3300049572 Ga0501036_0027153 Ga0501036_0027153_1149_1772 196
19 3300049573 Ga0501037_0021360 Ga0501037_0021360_3171_3794 196
20 3300049574 Ga0501038_0614302 Ga0501038_0614302_37_660 196
21 3300049583 Ga0501067_0000134 Ga0501067_0000134_16463_17086 196
22 3300049584 Ga0501068_0000980 Ga0501068_0000980_10823_11446 196
23 3300049589 Ga0501073_0000003 Ga0501073_0000003_233112_233735 196
24 3300049593 Ga0501077_0000001 Ga0501077_0000001_222567_223190 196
25 3300049742 Ga0501080_0004514 Ga0501080_0004514_3211_3834 196
26 3300049823 Ga0501044_0003199 Ga0501044_0003199_1613_2236 196
27 3300060353 Ga0501082_0401717 Ga0501082_0401717_312_935 196
28 3300005343 Ga0070687_100127781 Ga0070687_1001277812 197
29 3300005842 Ga0068858_100005484 Ga0068858_10000548411 197
30 3300006237 Ga0097621_100009170 Ga0097621_10000917016 197
31 3300006237 Ga0097621_100054695 Ga0097621_1000546954 197
32 3300006358 Ga0068871_100077751 Ga0068871_1000777516 197
33 3300006358 Ga0068871_100148720 Ga0068871_1001487204 197
34 3300009093 Ga0105240_11240641 Ga0105240_112406411 197
35 3300011119 Ga0105246_10131382 Ga0105246_101313822 197
36 3300014969 Ga0157376_10000689 Ga0157376_1000068917 197
37 3300025918 Ga0207662_10091475 Ga0207662_100914752 197
38 3300026035 Ga0207703_10003362 Ga0207703_1000336218 197
39 3300031730 Ga0307516_10014660 Ga0307516_100146603 197
40 3300044842 Ga0466957_0128828 Ga0466957_0128828_913_1554 197
41 3300047319 Ga0495674_0074099 Ga0495674_0074099_1897_2532 197
42 3300047471 Ga0495684_0139479 Ga0495684_0139479_778_1413 197
43 3300003323 rootH1_10273622 rootH1_102736223 198
44 3300005341 Ga0070691_10000022 Ga0070691_1000002229 198
45 3300005530 Ga0070679_100060389 Ga0070679_1000603895 198
46 3300005563 Ga0068855_100047864 Ga0068855_10004786410 198
47 3300005563 Ga0068855_100121419 Ga0068855_1001214193 198
48 3300005563 Ga0068855_100475321 Ga0068855_1004753212 198
49 3300005577 Ga0068857_100679861 Ga0068857_1006798612 198
50 3300005844 Ga0068862_100058891 Ga0068862_1000588915 198
51 3300006028 Ga0070717_10010547 Ga0070717_100105473 198
52 3300006931 Ga0097620_100000373 Ga0097620_10000037372 198
53 3300009098 Ga0105245_10010285 Ga0105245_1001028515 198
54 3300009176 Ga0105242_10087892 Ga0105242_100878922 198
55 3300009177 Ga0105248_10282317 Ga0105248_102823172 198
56 3300009551 Ga0105238_10597035 Ga0105238_105970352 198
57 3300013297 Ga0157378_10240947 Ga0157378_102409473 198
58 3300013306 Ga0163162_10044179 Ga0163162_1004417910 198
59 3300014326 Ga0157380_10002255 Ga0157380_100022552 198
60 3300014326 Ga0157380_10049225 Ga0157380_100492256 198
61 3300017792 Ga0163161_10005890 Ga0163161_1000589011 198
62 3300021384 Ga0213876_10000139 Ga0213876_1000013957 198
63 3300025912 Ga0207707_10193444 Ga0207707_101934442 198
64 3300025921 Ga0207652_10046019 Ga0207652_100460198 198
65 3300025921 Ga0207652_10126652 Ga0207652_101266524 198
66 3300025924 Ga0207694_10048224 Ga0207694_100482243 198
67 3300025927 Ga0207687_10014360 Ga0207687_100143609 198
68 3300025934 Ga0207686_10303516 Ga0207686_103035162 198
69 3300025935 Ga0207709_10020002 Ga0207709_100200022 198
70 3300025949 Ga0207667_10004525 Ga0207667_1000452517 198
71 3300025949 Ga0207667_10066820 Ga0207667_100668204 198
72 3300026075 Ga0207708_10079710 Ga0207708_100797106 198
73 3300026088 Ga0207641_10327888 Ga0207641_103278882 198
74 3300026116 Ga0207674_10357595 Ga0207674_103575953 198
75 3300026121 Ga0207683_10830246 Ga0207683_108302462 198
76 3300028380 Ga0268265_10914934 Ga0268265_109149342 198
77 3300028558 Ga0265326_10000108 Ga0265326_1000010832 198
78 3300028573 Ga0265334_10009073 Ga0265334_100090735 198
79 3300028800 Ga0265338_10001236 Ga0265338_100012363 198
80 3300028800 Ga0265338_10120981 Ga0265338_101209812 198
81 3300035086 Ga0373934_0085450 Ga0373934_0085450_169_798 198
82 3300035112 Ga0373932_0000027 Ga0373932_0000027_23353_23988 198
83 3300036401 Ga0373937_0438129 Ga0373937_0438129_481_1110 198
84 3300037312 Ga0395899_0000531 Ga0395899_0000531_2402_3040 198
85 3300037312 Ga0395899_0006178 Ga0395899_0006178_6240_6875 198
86 3300037312 Ga0395899_0040860 Ga0395899_0040860_299_937 198
87 3300037312 Ga0395899_0082054 Ga0395899_0082054_60_686 198
88 3300037418 Ga0395900_0000792 Ga0395900_0000792_14677_15408 198
89 3300037418 Ga0395900_0001179 Ga0395900_0001179_341_976 198
90 3300037418 Ga0395900_0002020 Ga0395900_0002020_19313_19951 198
91 3300037418 Ga0395900_0013066 Ga0395900_0013066_3232_3873 198
92 3300037418 Ga0395900_0189603 Ga0395900_0189603_905_1543 198
93 3300037418 Ga0395900_0191204 Ga0395900_0191204_765_1400 198
94 3300037466 Ga0395898_0001100 Ga0395898_0001100_37169_37900 198
95 3300037466 Ga0395898_0003723 Ga0395898_0003723_400_1035 198
96 3300037466 Ga0395898_0008196 Ga0395898_0008196_8119_8757 198
97 3300037466 Ga0395898_0054993 Ga0395898_0054993_2049_2687 198
98 3300037466 Ga0395898_0110205 Ga0395898_0110205_1924_2565 198
99 3300037466 Ga0395898_0233148 Ga0395898_0233148_721_1356 198
100 3300037471 Ga0395905_0000784 Ga0395905_0000784_26298_26936 198
101 3300038443 Ga0395901_0000606 Ga0395901_0000606_19046_19684 198
102 3300038443 Ga0395901_0005118 Ga0395901_0005118_4484_5122 198
103 3300038443 Ga0395901_0053648 Ga0395901_0053648_2914_3549 198
104 3300039437 Ga0436365_0464075 Ga0436365_0464075_24488_25114 198
105 3300046462 Ga0495651_0147353 Ga0495651_0147353_115_744 198
106 3300046463 Ga0495653_0405930 Ga0495653_0405930_153_782 198
107 3300046507 Ga0495606_0046449 Ga0495606_0046449_143_778 198
108 3300046511 Ga0495608_0035804 Ga0495608_0035804_58_687 198
109 3300046514 Ga0495618_0272575 Ga0495618_0272575_274_903 198
110 3300046516 Ga0495628_0451681 Ga0495628_0451681_170_799 198
111 3300046517 Ga0495630_0018194 Ga0495630_0018194_4403_5038 198
112 3300046674 Ga0495588_0046387 Ga0495588_0046387_1472_2107 198
113 3300046675 Ga0495657_0422647 Ga0495657_0422647_110_739 198
114 3300046689 Ga0495613_0048773 Ga0495613_0048773_2329_2958 198
115 3300047317 Ga0495604_0449082 Ga0495604_0449082_86_715 198
116 3300047322 Ga0495680_0272588 Ga0495680_0272588_32_661 198
117 3300047444 Ga0495675_0342012 Ga0495675_0342012_104_733 198
118 3300048907 Ga0496104_0762967 Ga0496104_0762967_80_715 198
119 3300053084 Ga0495595_0045147 Ga0495595_0045147_479_1108 198
120 3300053085 Ga0495619_0272300 Ga0495619_0272300_481_1110 198
121 3300053102 Ga0500554_000010 Ga0500554_000010_22179_22814 198
122 3300053144 Ga0500585_045155 Ga0500585_045155_672_1307 198
123 3300053150 Ga0500603_000048 Ga0500603_000048_27441_28076 198
124 3300053162 Ga0500638_000035 Ga0500638_000035_6477_7112 198
125 3300053178 Ga0500637_0000100 Ga0500637_0000100_21745_22380 198
126 3300009177 Ga0105248_10281488 Ga0105248_102814884 199
127 3300037418 Ga0395900_0083288 Ga0395900_0083288_1401_2030 199
128 3300044712 Ga0453684_0326890 Ga0453684_0326890_903_1535 199
129 3300046684 Ga0495669_0185830 Ga0495669_0185830_145_768 199
130 3300013104 Ga0157370_10246142 Ga0157370_102461423 200
131 3300037418 Ga0395900_0013570 Ga0395900_0013570_4355_5002 200
132 3300038443 Ga0395901_0013110 Ga0395901_0013110_4347_4994 200
133 iso_pu_bacteria 2970149975 2970150653 202
134 3300031251 Ga0265327_10056796 Ga0265327_100567965 203
135 3300005577 Ga0068857_100005208 Ga0068857_10000520817 204
136 3300005614 Ga0068856_100012262 Ga0068856_10001226210 204
137 3300005616 Ga0068852_100037498 Ga0068852_1000374985 204
138 3300026078 Ga0207702_10002680 Ga0207702_1000268032 204
139 3300026116 Ga0207674_10005171 Ga0207674_1000517110 204
140 3300026142 Ga0207698_10309549 Ga0207698_103095492 204
141 3300003320 rootH2_10312338 rootH2_103123382 206
142 3300003322 rootL2_10061741 rootL2_100617412 206
143 3300005578 Ga0068854_100318050 Ga0068854_1003180501 206
144 3300005614 Ga0068856_100139657 Ga0068856_1001396572 206
145 3300005616 Ga0068852_100084274 Ga0068852_1000842744 206
146 3300006946 Ga0079104_1011238 Ga0079104_10112382 206
147 3300009545 Ga0105237_10122509 Ga0105237_101225092 206
148 3300009551 Ga0105238_10226277 Ga0105238_102262772 206
149 3300021320 Ga0214544_1001101 Ga0214544_100110162 206
150 3300025298 Ga0209050_1031072 Ga0209050_10310722 206
151 3300025303 Ga0209051_1002247 Ga0209051_100224717 206
152 3300025914 Ga0207671_10262995 Ga0207671_102629952 206
153 3300025924 Ga0207694_10007094 Ga0207694_100070946 206
154 3300025981 Ga0207640_10228377 Ga0207640_102283773 206
155 3300026078 Ga0207702_10143896 Ga0207702_101438961 206
156 3300026142 Ga0207698_10036751 Ga0207698_100367513 206
157 3300027111 Ga0209281_1002528 Ga0209281_10025288 206
158 3300031967 Ga0315914_1000381 Ga0315914_100038166 206
159 3300033430 Ga0315913_1000080 Ga0315913_100008013 206
160 3300033464 Ga0315915_1000191 Ga0315915_100019166 206
161 3300046501 Ga0495607_0000302 Ga0495607_0000302_15070_15732 206
162 3300046538 Ga0495609_0000550 Ga0495609_0000550_20463_21119 206
163 3300047444 Ga0495675_0040570 Ga0495675_0040570_1380_2045 206
164 3300049570 Ga0501033_0008348 Ga0501033_0008348_7144_7824 206
165 3300049822 Ga0501035_0000468 Ga0501035_0000468_4005_4685 206
166 iso_pu_bacteria 2513237091 2513617562 206
167 iso_pu_bacteria 2516653046 2516893463 206
168 iso_pu_bacteria 2551306085 2551684410 206
169 iso_pu_bacteria 2916014648 2916020179 206
170 iso_pu_bacteria 2916021584 2916023466 206
171 iso_pu_bacteria 2936996657 2937000248 206
172 iso_pu_bacteria 2937002841 2937008397 206
173 iso_pu_bacteria 2937009748 2937014721 206
174 iso_pu_bacteria 2957505466 2957507407 206
175 iso_pu_bacteria 2957505466 2957511459 206
176 iso_pu_bacteria 2960652885 2960655701 206
177 iso_pu_bacteria 8003992118 8003992843 206

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09588

YqaJ

YqaJ-like viral recombinase domain

42

183

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sz4-assembly1.cif.gz_A crystal structure of lhk-exo in complex with damp 0.9747 2 195
3syy-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9727 2 195
3slp-assembly1.cif.gz_B crystal structure of lambda exonuclease in complex with a 12 bp symmetric dna duplex 0.9417 2 188
3sz4-assembly1.cif.gz_A crystal structure of lhk-exo in complex with damp 0.9306 2 195
3syy-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9284 2 195
ID Description Score Start End Superfamily
3syyA00 Alpha Beta;Alpha-Beta Complex;Lambda Exonuclease; Chain A; 0.9727 2 195 3.90.320.10
3syyA00 Alpha Beta;Alpha-Beta Complex;Lambda Exonuclease; Chain A; 0.9284 2 195 3.90.320.10
1avqA00 Alpha Beta;Alpha-Beta Complex;Lambda Exonuclease; Chain A; 0.9142 2 188 3.90.320.10
1avqA00 Alpha Beta;Alpha-Beta Complex;Lambda Exonuclease; Chain A; 0.8302 2 188 3.90.320.10
af_Q8GW93_101_301_3.90.320.10 Alpha Beta;Alpha-Beta Complex;Lambda Exonuclease; Chain A; 0.8187 4 180 3.90.320.10
ID Description Score Start End GO Terms
AF-A0A1B9NMM8-F1-model_v4 Exonuclease 0.9915 2 188 GO:0004527
AF-J0QZQ1-F1-model_v4 YqaJ viral recombinase domain-containing protein 0.988 2 193
AF-E6YUL8-F1-model_v4 Phage-related exonuclease (EC 3.1.11.3) 0.9879 74 173 GO:0051908
AF-J1K5V1-F1-model_v4 deleted 0.9865 2 149
AF-A0A2D1LTH8-F1-model_v4 Exodeoxyribonuclease (Lambda-induced) (EC 3.1.11.3) 0.9849 86 173 GO:0051908

Feature Viewer

pLDDT pTM Quality
92.34 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map