F270567

General Info

Members Datasets Scaffolds Average Seq Length
177 136 354 194

Family's Representative Sequence

Representative Sequence 3300036712|Ga0316584_0038240|Ga0316584_0038240_2044_2721
Length 225
Sequence LQRHALRDNGALKLAPTDDPTARRPALRNAPMVLMIDNYDSFTYNLVQYLGELGAEVRVLRNDETTVEDALALGPASIVVSPGPCTPDEAGISVPLIRAAAGRVPVLGVCLGHQSIGRAFGAKIIRARAVMHGKTSPIHHAGQGIFSGLETPFDATRYHSLVIDADSLPPELEVTAWTCTEDGSRDEIMGVRHRELPVQGVQFHPESILTQHGHELLANFLANQT

Samples

Sample ID Description Type Environment
1 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
43 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
75 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
76 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
77 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
78 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
81 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
82 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
83 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
84 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
85 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
89 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
90 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
91 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
92 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
95 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
96 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
97 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
100 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
101 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
102 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
103 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
104 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
105 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
106 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
109 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
110 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
111 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
112 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
113 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
118 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
119 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
121 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
122 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
123 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
124 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
125 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
126 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
127 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
128 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
129 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
130 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
131 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
132 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
133 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
134 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
135 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
136 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.66
Metatranscriptomes 2.26
Isolates 5.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.08
Nodule 0
Rhizoplane 3.39
Rhizosphere 85.88
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316584_0038240 3300036712 Bacteria 3568
2 Ga0070658_10000189 3300005327 Bacteria 54405
3 Ga0070658_10018814 3300005327 Bacteria 5534
4 Ga0070670_100222029 3300005331 Bacteria 1644
5 Ga0070682_100000160 3300005337 Bacteria 51653
6 Ga0068868_100054212 3300005338 Bacteria 3159
7 Ga0070660_100189004 3300005339 Bacteria 1668
8 Ga0070661_100950580 3300005344 Bacteria 711
9 Ga0070669_100119570 3300005353 Bacteria 2008
10 Ga0070667_100313325 3300005367 Bacteria 1415
11 Ga0070714_100397041 3300005435 Bacteria 1303
12 Ga0070713_100741963 3300005436 Bacteria 939
13 Ga0070708_100003756 3300005445 Bacteria 11914
14 Ga0070708_100009382 3300005445 Bacteria 7888
15 Ga0070708_100014585 3300005445 Bacteria 6474
16 Ga0070678_100455513 3300005456 Bacteria 1121
17 Ga0070681_10218049 3300005458 Bacteria 1824
18 Ga0070681_10621821 3300005458 Bacteria 995
19 Ga0070706_100000277 3300005467 Bacteria 62380
20 Ga0070706_100006602 3300005467 Bacteria 10942
21 Ga0070706_100255100 3300005467 Bacteria 1637
22 Ga0070706_101345054 3300005467 Bacteria 654
23 Ga0070707_100000029 3300005468 Bacteria 123116
24 Ga0070707_100015627 3300005468 Bacteria 7123
25 Ga0070707_100243464 3300005468 Bacteria 1750
26 Ga0070707_100302937 3300005468 Bacteria 1553
27 Ga0070698_100000166 3300005471 Bacteria 60815
28 Ga0070698_100002960 3300005471 Bacteria 18689
29 Ga0070698_100012745 3300005471 Bacteria 8904
30 Ga0070698_100093856 3300005471 Bacteria 2980
31 Ga0070698_100472422 3300005471 Bacteria 1190
32 Ga0070699_100000066 3300005518 Bacteria 99262
33 Ga0070699_100354650 3300005518 Bacteria 1322
34 Ga0070697_100176236 3300005536 Bacteria 1811
35 Ga0068855_100041487 3300005563 Bacteria 5454
36 Ga0068855_100290463 3300005563 Bacteria 1813
37 Ga0068852_100056091 3300005616 Bacteria 3403
38 Ga0068864_100187389 3300005618 Bacteria 1895
39 Ga0068862_100249844 3300005844 Bacteria 1616
40 Ga0081540_1032051 3300005983 Bacteria 2876
41 Ga0081539_10198531 3300005985 Bacteria 928
42 Ga0070717_10040211 3300006028 Bacteria 3808
43 Ga0070717_10152751 3300006028 Bacteria 1998
44 Ga0075362_10000251 3300006177 Bacteria 14883
45 Ga0075366_10062540 3300006195 Bacteria 2212
46 Ga0075370_10164412 3300006353 Bacteria 1303
47 Ga0068871_100853116 3300006358 Bacteria 842
48 Ga0105240_10028516 3300009093 Bacteria 7291
49 Ga0105245_10595272 3300009098 Bacteria 1132
50 Ga0105243_10618019 3300009148 Bacteria 1045
51 Ga0105237_10567831 3300009545 Bacteria 1141
52 Ga0105239_10004270 3300010375 Bacteria 17141
53 Ga0105246_10488124 3300011119 Bacteria 1043
54 Ga0157370_10248709 3300013104 Bacteria 1645
55 Ga0157374_10424609 3300013296 Bacteria 1328
56 Ga0163162_10171971 3300013306 Bacteria 2291
57 Ga0163162_10647189 3300013306 Bacteria 1181
58 Ga0157375_10153915 3300013308 Bacteria 2437
59 Ga0157376_10246536 3300014969 Bacteria 1667
60 Ga0213872_10024156 3300021361 Bacteria 2795
61 Ga0207705_10000737 3300025909 Bacteria 27014
62 Ga0207705_10147421 3300025909 Bacteria 1761
63 Ga0207684_10000008 3300025910 Bacteria 601602
64 Ga0207684_10002802 3300025910 Bacteria 17333
65 Ga0207684_10003022 3300025910 Bacteria 16672
66 Ga0207684_10099979 3300025910 Bacteria 2478
67 Ga0207707_10585825 3300025912 Bacteria 945
68 Ga0207695_10032522 3300025913 Bacteria 5707
69 Ga0207657_10310288 3300025919 Bacteria 1249
70 Ga0207649_10285953 3300025920 Bacteria 1201
71 Ga0207646_10000142 3300025922 Bacteria 98159
72 Ga0207646_10000475 3300025922 Bacteria 53587
73 Ga0207646_10000859 3300025922 Bacteria 39238
74 Ga0207646_10005675 3300025922 Bacteria 13087
75 Ga0207646_10012619 3300025922 Bacteria 8110
76 Ga0207646_10254792 3300025922 Bacteria 1586
77 Ga0207664_10273727 3300025929 Bacteria 1480
78 Ga0207664_10355784 3300025929 Bacteria 1297
79 Ga0207706_10087601 3300025933 Bacteria 2738
80 Ga0207665_10084251 3300025939 Bacteria 2194
81 Ga0207665_10369070 3300025939 Bacteria 1087
82 Ga0207667_10085187 3300025949 Bacteria 3272
83 Ga0207677_10926785 3300026023 Bacteria 786
84 Ga0207703_10727981 3300026035 Bacteria 944
85 Ga0207639_10116380 3300026041 Bacteria 2188
86 Ga0207708_10421563 3300026075 Bacteria 1107
87 Ga0207676_10492730 3300026095 Bacteria 1162
88 Ga0207683_11113304 3300026121 Bacteria 732
89 Ga0207698_10004074 3300026142 Bacteria 8872
90 Ga0209969_1000213 3300027360 Bacteria 7829
91 Ga0209967_1001482 3300027364 Bacteria 3012
92 Ga0209984_1000765 3300027424 Bacteria 3444
93 Ga0210000_1000399 3300027462 Bacteria 6039
94 Ga0209995_1000462 3300027471 Bacteria 6215
95 Ga0209968_1006099 3300027526 Bacteria 1815
96 Ga0209970_1004642 3300027614 Bacteria 2275
97 Ga0210002_1015618 3300027617 Bacteria 1197
98 Ga0209983_1005395 3300027665 Bacteria 2651
99 Ga0209971_1011764 3300027682 Bacteria 2073
100 Ga0209974_10000335 3300027876 Bacteria 15422
101 Ga0207428_10333993 3300027907 Bacteria 1117
102 Ga0268266_11143984 3300028379 Bacteria 753
103 Ga0265316_10399812 3300031344 Bacteria 990
104 Ga0316575_10009110 3300031665 Bacteria 3630
105 Ga0316575_10013349 3300031665 Bacteria 3067
106 Ga0316575_10065047 3300031665 Bacteria 1460
107 Ga0316579_10000866 3300031691 Bacteria 10471
108 Ga0316576_10002419 3300031727 Bacteria 10600
109 Ga0316576_10157297 3300031727 Bacteria 1713
110 Ga0316578_10050898 3300031728 Bacteria 2424
111 Ga0307405_10097688 3300031731 Bacteria 1962
112 Ga0316577_10024102 3300031733 Bacteria 3381
113 Ga0316577_10146545 3300031733 Bacteria 1330
114 Ga0307412_10987951 3300031911 Bacteria 743
115 Ga0316583_10006597 3300032133 Bacteria 4173
116 Ga0316585_10000840 3300032137 Bacteria 7800
117 Ga0316580_10001433 3300032139 Bacteria 6224
118 Ga0316593_10052299 3300032168 Bacteria 1382
119 Ga0316593_10072168 3300032168 Bacteria 1195
120 Ga0316588_1000404 3300033528 Bacteria 5724
121 Ga0316596_1055382 3300033541 Bacteria 1053
122 Ga0373934_0197140 3300035086 Bacteria 829
123 Ga0316574_0003658 3300035398 Bacteria 7961
124 Ga0316574_0318431 3300035398 Bacteria 988
125 Ga0316582_0033442 3300036647 Bacteria 3158
126 Ga0316584_0099961 3300036712 Bacteria 2172
127 Ga0316581_0008244 3300037588 Bacteria 2828
128 Ga0400483_179698 3300039062 Bacteria 3736
129 Ga0436365_1167783 3300039437 Bacteria 865
130 Ga0436361_0041324 3300039447 Bacteria 1804
131 Ga0436361_0264697 3300039447 Bacteria 16007
132 Ga0451835_0645847 3300041492 Bacteria 615
133 Ga0451577_0894029 3300042876 Bacteria 800
134 Ga0466963_0201752 3300044694 Bacteria 1391
135 Ga0451576_0339672 3300045051 Bacteria 1572
136 Ga0495643_0003256 3300046522 Bacteria 12009
137 Ga0495663_0000491 3300046525 Bacteria 14284
138 Ga0495642_0065165 3300046528 Bacteria 1516
139 Ga0495621_0000013 3300046539 Bacteria 38261
140 Ga0495661_0004739 3300046665 Bacteria 9770
141 Ga0495687_096645 3300047443 Bacteria 1117
142 Ga0495684_0085298 3300047471 Bacteria 2395
143 Ga0496108_0001562 3300048911 Bacteria 18134
144 Ga0496108_0071340 3300048911 Bacteria 2931
145 Ga0496109_0021323 3300048912 Bacteria 5728
146 Ga0496110_0317937 3300048913 Bacteria 1418
147 Ga0496113_0411570 3300048916 Bacteria 1086
148 Ga0496114_0009623 3300048917 Bacteria 7677
149 Ga0496122_0435362 3300048925 Bacteria 655
150 Ga0496124_0018513 3300048927 Bacteria 6519
151 Ga0501036_0296653 3300049572 Bacteria 1352
152 Ga0501038_0000950 3300049574 Bacteria 25899
153 Ga0501038_0155257 3300049574 Bacteria 1864
154 Ga0501043_0302016 3300049579 Bacteria 1223
155 Ga0501047_0017823 3300049581 Bacteria 6803
156 Ga0501067_0484990 3300049583 Bacteria 691
157 Ga0501083_0096120 3300049744 Bacteria 1955
158 Ga0501035_0044516 3300049822 Bacteria 3997
159 Ga0501044_0000033 3300049823 Bacteria 167177
160 Ga0501044_0496093 3300049823 Bacteria 1123
161 nmdc:mga03683_293_c1 3300050489 Bacteria 14883
162 nmdc:mga03n38_31680_c1 3300050490 Bacteria 2233
163 nmdc:mga0k408_104_c3 3300050493 Bacteria 36143
164 nmdc:mga0k408_147_c2 3300050493 Bacteria 23821
165 nmdc:mga08y16_515956_c1 3300050511 Bacteria 1213
166 Ga0495601_0355765 3300053077 Bacteria 952
167 Ga0500555_000229 3300053103 Bacteria 25066
168 Ga0500556_0000203 3300053104 Bacteria 48653
169 2595320827 2593339198 Bacteria 7267884
170 2865002677 2864997549 Bacteria 5139696
171 2865008237 2865002811 Bacteria 6333767
172 2888579000 2888578766 Bacteria 6743310
173 2889052457 2889049205 Bacteria 7524325
174 2929207156 2929206907 Bacteria 5918291
175 2998347184 2998344455 Bacteria 4222996
176 3006992450 3006988479 Bacteria 4767936
177 8055634068 8055632911 Bacteria 5283357
178 Ga0316584_0038240
179 Ga0070658_10000189
180 Ga0070658_10018814
181 Ga0070670_100222029
182 Ga0070682_100000160
183 Ga0068868_100054212
184 Ga0070660_100189004
185 Ga0070661_100950580
186 Ga0070669_100119570
187 Ga0070667_100313325
188 Ga0070714_100397041
189 Ga0070713_100741963
190 Ga0070708_100003756
191 Ga0070708_100009382
192 Ga0070708_100014585
193 Ga0070678_100455513
194 Ga0070681_10218049
195 Ga0070681_10621821
196 Ga0070706_100000277
197 Ga0070706_100006602
198 Ga0070706_100255100
199 Ga0070706_101345054
200 Ga0070707_100000029
201 Ga0070707_100015627
202 Ga0070707_100243464
203 Ga0070707_100302937
204 Ga0070698_100000166
205 Ga0070698_100002960
206 Ga0070698_100012745
207 Ga0070698_100093856
208 Ga0070698_100472422
209 Ga0070699_100000066
210 Ga0070699_100354650
211 Ga0070697_100176236
212 Ga0068855_100041487
213 Ga0068855_100290463
214 Ga0068852_100056091
215 Ga0068864_100187389
216 Ga0068862_100249844
217 Ga0081540_1032051
218 Ga0081539_10198531
219 Ga0070717_10040211
220 Ga0070717_10152751
221 Ga0075362_10000251
222 Ga0075366_10062540
223 Ga0075370_10164412
224 Ga0068871_100853116
225 Ga0105240_10028516
226 Ga0105245_10595272
227 Ga0105243_10618019
228 Ga0105237_10567831
229 Ga0105239_10004270
230 Ga0105246_10488124
231 Ga0157370_10248709
232 Ga0157374_10424609
233 Ga0163162_10171971
234 Ga0163162_10647189
235 Ga0157375_10153915
236 Ga0157376_10246536
237 Ga0213872_10024156
238 Ga0207705_10000737
239 Ga0207705_10147421
240 Ga0207684_10000008
241 Ga0207684_10002802
242 Ga0207684_10003022
243 Ga0207684_10099979
244 Ga0207707_10585825
245 Ga0207695_10032522
246 Ga0207657_10310288
247 Ga0207649_10285953
248 Ga0207646_10000142
249 Ga0207646_10000475
250 Ga0207646_10000859
251 Ga0207646_10005675
252 Ga0207646_10012619
253 Ga0207646_10254792
254 Ga0207664_10273727
255 Ga0207664_10355784
256 Ga0207706_10087601
257 Ga0207665_10084251
258 Ga0207665_10369070
259 Ga0207667_10085187
260 Ga0207677_10926785
261 Ga0207703_10727981
262 Ga0207639_10116380
263 Ga0207708_10421563
264 Ga0207676_10492730
265 Ga0207683_11113304
266 Ga0207698_10004074
267 Ga0209969_1000213
268 Ga0209967_1001482
269 Ga0209984_1000765
270 Ga0210000_1000399
271 Ga0209995_1000462
272 Ga0209968_1006099
273 Ga0209970_1004642
274 Ga0210002_1015618
275 Ga0209983_1005395
276 Ga0209971_1011764
277 Ga0209974_10000335
278 Ga0207428_10333993
279 Ga0268266_11143984
280 Ga0265316_10399812
281 Ga0316575_10009110
282 Ga0316575_10013349
283 Ga0316575_10065047
284 Ga0316579_10000866
285 Ga0316576_10002419
286 Ga0316576_10157297
287 Ga0316578_10050898
288 Ga0307405_10097688
289 Ga0316577_10024102
290 Ga0316577_10146545
291 Ga0307412_10987951
292 Ga0316583_10006597
293 Ga0316585_10000840
294 Ga0316580_10001433
295 Ga0316593_10052299
296 Ga0316593_10072168
297 Ga0316588_1000404
298 Ga0316596_1055382
299 Ga0373934_0197140
300 Ga0316574_0003658
301 Ga0316574_0318431
302 Ga0316582_0033442
303 Ga0316584_0099961
304 Ga0316581_0008244
305 Ga0400483_179698
306 Ga0436365_1167783
307 Ga0436361_0041324
308 Ga0436361_0264697
309 Ga0451835_0645847
310 Ga0451577_0894029
311 Ga0466963_0201752
312 Ga0451576_0339672
313 Ga0495643_0003256
314 Ga0495663_0000491
315 Ga0495642_0065165
316 Ga0495621_0000013
317 Ga0495661_0004739
318 Ga0495687_096645
319 Ga0495684_0085298
320 Ga0496108_0001562
321 Ga0496108_0071340
322 Ga0496109_0021323
323 Ga0496110_0317937
324 Ga0496113_0411570
325 Ga0496114_0009623
326 Ga0496122_0435362
327 Ga0496124_0018513
328 Ga0501036_0296653
329 Ga0501038_0000950
330 Ga0501038_0155257
331 Ga0501043_0302016
332 Ga0501047_0017823
333 Ga0501067_0484990
334 Ga0501083_0096120
335 Ga0501035_0044516
336 Ga0501044_0000033
337 Ga0501044_0496093
338 nmdc:mga03683_293_c1
339 nmdc:mga03n38_31680_c1
340 nmdc:mga0k408_104_c3
341 nmdc:mga0k408_147_c2
342 nmdc:mga08y16_515956_c1
343 Ga0495601_0355765
344 Ga0500555_000229
345 Ga0500556_0000203
346 2595320827
347 2865002677
348 2865008237
349 2888579000
350 2889052457
351 2929207156
352 2998347184
353 3006992450
354 8055634068

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

34

224

0.95

PF07722

Peptidase_C26

Peptidase C26

80

206

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qdl-assembly1.cif.gz_B-2 the crystal structure of anthranilate synthase from sulfolobus solfataricus 0.9422 2 185
6qur-assembly1.cif.gz_A mapping the allosteric communication network of aminodeoxychorismate synthase 0.9377 1 187
6qur-assembly1.cif.gz_A mapping the allosteric communication network of aminodeoxychorismate synthase 0.9329 1 187
1qdl-assembly1.cif.gz_B-2 the crystal structure of anthranilate synthase from sulfolobus solfataricus 0.9227 2 185
8hx7-assembly1.cif.gz_B crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with l-glutamine 0.9222 2 184
ID Description Score Start End Superfamily
af_P00903_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9738 1 187 3.40.50.880
af_K7L2D7_74_267_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9634 2 187 3.40.50.880
af_Q2G099_1_189_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9591 1 186 3.40.50.880
af_P9WN35_1_200_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9534 2 186 3.40.50.880
af_K7L2D7_74_267_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9534 2 187 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A0C3RJA9-F1-model_v4 Anthranilate synthase component II (EC 4.1.3.27) 0.9958 44 161 GO:0000162
GO:0004049
GO:0005829
GO:0046654
GO:0046820
AF-A0A7M3PQ74-F1-model_v4 Athranilate synthase or para-amino-benzoate 0.9923 32 164 GO:0000162
GO:0004049
GO:0005829
AF-A0A800BQT8-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.9892 1 168 GO:0000162
GO:0004049
GO:0005829
AF-A0A2V8R0S8-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.9886 23 153 GO:0000162
GO:0004049
GO:0005829
AF-X0UEQ4-F1-model_v4 Glutamine amidotransferase domain-containing protein 0.9877 1 167 GO:0000162
GO:0004049
GO:0005829

Map