F270463

General Info

Members Datasets Scaffolds Average Seq Length
177 131 354 230

Family's Representative Sequence

Representative Sequence 3300031728|Ga0316578_10051862|Ga0316578_100518622
Length 256
Sequence MTNHPSTLPGVALSLSKGPLSERTRWVVVTAFAIAMAWVEAASVFYIRALVDRIEPYQANPLPIDGALGHVELWREAATLAMIAAVAVLAPLDSARGASSEXRRAGRTWRRRAGYAALAFGVWDIFYYVFLHLISGWPRTLLDWDILFLLPLPWWGPVLAPASIALVMILWGTLATQSDEATGTRWTWALASVGAVLALGVFMIDAWRALPDGRDAVLQVLPATFNWPLFWVAWLLMASPVLHRMAFLRTRDVRPR

Samples

Sample ID Description Type Environment
1 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
74 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
75 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
76 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
79 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
80 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
81 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
82 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
83 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
84 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
85 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
86 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
87 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
88 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
89 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
90 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
91 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
92 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
93 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
94 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
95 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
96 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
97 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
98 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
99 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
100 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
111 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
112 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
113 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
114 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
115 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
116 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
117 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
118 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
119 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
120 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
121 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
122 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
123 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
124 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
125 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
126 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
127 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
128 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
129 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
130 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
131 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.78
Rhizosphere 93.22
Stem 0
Stem Tuber 0
Unclassified 28.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316578_10051862 3300031728 Bacteria 2403
2 Ga0070658_10076105 3300005327 Bacteria 2753
3 Ga0070690_100024298 3300005330 Bacteria 3726
4 Ga0070670_100030257 3300005331 Unclassified 4662
5 Ga0070670_100275418 3300005331 Unclassified 1469
6 Ga0070666_10196437 3300005335 Bacteria 1419
7 Ga0070689_100050010 3300005340 Bacteria 3228
8 Ga0070689_100154357 3300005340 Bacteria 1853
9 Ga0070687_100001021 3300005343 Bacteria 9541
10 Ga0070661_100161941 3300005344 Bacteria 1695
11 Ga0070669_100177843 3300005353 Bacteria 1663
12 Ga0070675_100000902 3300005354 Bacteria 21140
13 Ga0070675_100030257 3300005354 Bacteria 4370
14 Ga0070674_100907998 3300005356 Bacteria 768
15 Ga0070659_100567443 3300005366 Bacteria 973
16 Ga0070714_100019876 3300005435 Bacteria 5479
17 Ga0070705_100038668 3300005440 Unclassified 2701
18 Ga0070694_100470938 3300005444 Unclassified 995
19 Ga0070662_100643951 3300005457 Bacteria 894
20 Ga0068867_100459177 3300005459 Unclassified 1087
21 Ga0070684_100133472 3300005535 Unclassified 2241
22 Ga0070697_100336121 3300005536 Bacteria 1303
23 Ga0068853_100850103 3300005539 Unclassified 875
24 Ga0070672_100438324 3300005543 Unclassified 1124
25 Ga0070686_100000416 3300005544 Bacteria 26875
26 Ga0070695_100250058 3300005545 Bacteria 1290
27 Ga0070696_100014444 3300005546 Bacteria 5296
28 Ga0068855_100191313 3300005563 Unclassified 2308
29 Ga0070664_100127725 3300005564 Bacteria 2231
30 Ga0068854_100278039 3300005578 Bacteria 1347
31 Ga0068856_100018706 3300005614 Bacteria 6715
32 Ga0068856_100359248 3300005614 Bacteria 1475
33 Ga0068859_100195679 3300005617 Bacteria 2106
34 Ga0068859_100689022 3300005617 Unclassified 1113
35 Ga0068863_100564242 3300005841 Bacteria 1125
36 Ga0068862_100087318 3300005844 Bacteria 2713
37 Ga0075432_10053411 3300006058 Bacteria 1429
38 Ga0097621_100004762 3300006237 Bacteria 9492
39 Ga0068871_100000687 3300006358 Bacteria 23018
40 Ga0075428_100532349 3300006844 Bacteria 1256
41 Ga0075430_100002337 3300006846 Bacteria 15760
42 Ga0075431_100013276 3300006847 Bacteria 8322
43 Ga0075431_100143472 3300006847 Bacteria 2461
44 Ga0075431_100389769 3300006847 Unclassified 1396
45 Ga0075431_100607860 3300006847 Unclassified 1077
46 Ga0097620_100195695 3300006931 Bacteria 2106
47 Ga0097620_100689070 3300006931 Unclassified 1113
48 Ga0075435_100162607 3300007076 Bacteria 1881
49 Ga0075435_100177427 3300007076 Bacteria 1799
50 Ga0075435_100316499 3300007076 Unclassified 1335
51 Ga0111539_10208340 3300009094 Bacteria 2278
52 Ga0111539_10208832 3300009094 Bacteria 2275
53 Ga0111539_10282470 3300009094 Bacteria 1931
54 Ga0111539_10392571 3300009094 Bacteria 1616
55 Ga0111539_10701769 3300009094 Bacteria 1178
56 Ga0114129_10015007 3300009147 Bacteria 11031
57 Ga0114129_10080026 3300009147 Bacteria 4543
58 Ga0114129_10170790 3300009147 Bacteria 2964
59 Ga0105248_10089069 3300009177 Unclassified 3473
60 Ga0105248_10110758 3300009177 Unclassified 3096
61 Ga0105248_10125394 3300009177 Bacteria 2897
62 Ga0105248_10141193 3300009177 Bacteria 2717
63 Ga0105248_10688394 3300009177 Unclassified 1153
64 Ga0163162_10907628 3300013306 Unclassified 994
65 Ga0157372_10536544 3300013307 Unclassified 1364
66 Ga0157375_10254539 3300013308 Unclassified 1917
67 Ga0163163_10000048 3300014325 Bacteria 130746
68 Ga0157380_10005731 3300014326 Bacteria 8694
69 Ga0157377_10027444 3300014745 Bacteria 3057
70 Ga0157376_10620925 3300014969 Bacteria 1078
71 Ga0207688_10122710 3300025901 Bacteria 1517
72 Ga0207705_10454897 3300025909 Bacteria 993
73 Ga0207695_10453848 3300025913 Bacteria 1165
74 Ga0207649_10093590 3300025920 Bacteria 1973
75 Ga0207646_10475352 3300025922 Bacteria 1127
76 Ga0207681_10159151 3300025923 Bacteria 1700
77 Ga0207681_10343018 3300025923 Bacteria 1194
78 Ga0207650_10040038 3300025925 Unclassified 3428
79 Ga0207650_10176652 3300025925 Unclassified 1700
80 Ga0207659_10000086 3300025926 Bacteria 55279
81 Ga0207659_10033943 3300025926 Bacteria 3515
82 Ga0207690_10095872 3300025932 Unclassified 2108
83 Ga0207706_10635017 3300025933 Bacteria 915
84 Ga0207686_10485814 3300025934 Unclassified 956
85 Ga0207711_10062548 3300025941 Unclassified 3210
86 Ga0207711_10075117 3300025941 Bacteria 2941
87 Ga0207679_10016449 3300025945 Bacteria 4914
88 Ga0207667_10157865 3300025949 Unclassified 2334
89 Ga0207667_10615123 3300025949 Bacteria 1094
90 Ga0207640_10453387 3300025981 Bacteria 1057
91 Ga0207639_10463186 3300026041 Bacteria 1153
92 Ga0207708_10228382 3300026075 Bacteria 1494
93 Ga0207708_10274505 3300026075 Unclassified 1364
94 Ga0207702_10057529 3300026078 Bacteria 3305
95 Ga0207702_10202115 3300026078 Unclassified 1842
96 Ga0207648_10383155 3300026089 Unclassified 1272
97 Ga0207675_100977382 3300026118 Unclassified 865
98 Ga0209974_10048883 3300027876 Unclassified 1418
99 Ga0268265_10048536 3300028380 Bacteria 3187
100 Ga0268264_10133644 3300028381 Bacteria 2203
101 Ga0316578_10079465 3300031728 Bacteria 1950
102 Ga0307405_10280460 3300031731 Bacteria 1254
103 Ga0307411_10070019 3300032005 Bacteria 2372
104 Ga0307415_100599623 3300032126 Bacteria 980
105 Ga0373928_0065209 3300035084 Bacteria 889
106 Ga0373937_0202887 3300036401 Unclassified 1864
107 Ga0439431_0034891 3300041997 Bacteria 1263
108 Ga0439450_109864 3300042008 Bacteria 705
109 Ga0439435_0010719 3300042436 Bacteria 2183
110 Ga0439435_0014227 3300042436 Bacteria 1964
111 Ga0439444_0013304 3300042437 Bacteria 1362
112 Ga0451577_0040282 3300042876 Unclassified 4195
113 Ga0453684_0061127 3300044712 Unclassified 4839
114 Ga0451576_0031133 3300045051 Bacteria 5691
115 Ga0495580_0033913 3300046472 Bacteria 3676
116 Ga0495647_0057037 3300046681 Bacteria 1532
117 Ga0495613_0445673 3300046689 Unclassified 878
118 Ga0495581_0177255 3300047315 Bacteria 1246
119 Ga0495636_0337547 3300047318 Bacteria 710
120 Ga0496100_0947779 3300048903 Bacteria 677
121 Ga0496101_0270553 3300048904 Bacteria 1326
122 Ga0496102_0529904 3300048905 Bacteria 1100
123 Ga0496103_0252162 3300048906 Bacteria 1136
124 Ga0496105_0739739 3300048908 Unclassified 752
125 Ga0496108_0531649 3300048911 Bacteria 1026
126 Ga0496110_0197527 3300048913 Bacteria 1827
127 Ga0496111_0364375 3300048914 Unclassified 1070
128 Ga0496112_0029712 3300048915 Bacteria 5288
129 Ga0496112_0074435 3300048915 Bacteria 3358
130 Ga0496113_0073327 3300048916 Bacteria 2608
131 Ga0496113_0112347 3300048916 Bacteria 2122
132 Ga0501032_0185242 3300049569 Unclassified 1362
133 Ga0501033_0031090 3300049570 Unclassified 4014
134 Ga0501036_0002691 3300049572 Bacteria 14026
135 Ga0501038_0023825 3300049574 Bacteria 5466
136 Ga0501040_0007404 3300049576 Bacteria 7108
137 Ga0501041_0015709 3300049577 Unclassified 4496
138 Ga0501042_0038114 3300049578 Bacteria 3413
139 Ga0501043_0063415 3300049579 Bacteria 2902
140 Ga0501046_0069051 3300049580 Bacteria 2750
141 Ga0501048_0023878 3300049582 Unclassified 4466
142 Ga0501068_0009318 3300049584 Bacteria 5490
143 Ga0501071_0010985 3300049587 Bacteria 6080
144 Ga0501072_0061492 3300049588 Unclassified 2962
145 Ga0501072_0468083 3300049588 Unclassified 998
146 Ga0501074_0102415 3300049590 Unclassified 2050
147 Ga0501074_0126420 3300049590 Bacteria 1829
148 Ga0501075_0001124 3300049591 Bacteria 17236
149 Ga0501076_0005964 3300049592 Bacteria 8795
150 Ga0501076_0451654 3300049592 Bacteria 1058
151 Ga0501076_0696384 3300049592 Unclassified 839
152 Ga0501077_0039339 3300049593 Bacteria 3012
153 Ga0501079_0089314 3300049741 Unclassified 2386
154 Ga0501080_0299646 3300049742 Bacteria 1458
155 Ga0501081_0000152 3300049743 Bacteria 31785
156 Ga0501081_0688348 3300049743 Unclassified 767
157 Ga0501045_0004849 3300049824 Bacteria 9308
158 nmdc:mga05p37_11132_c1 3300050507 Bacteria 10689
159 nmdc:mga05p37_27714_c1 3300050507 Bacteria 6901
160 nmdc:mga05p37_297253_c1 3300050507 Bacteria 1920
161 nmdc:mga05p37_37140_c1 3300050507 Bacteria 5975
162 nmdc:mga05p37_395776_c1 3300050507 Bacteria 1614
163 nmdc:mga09592_153764_c1 3300050508 Bacteria 1985
164 nmdc:mga0qj67_1968_c1 3300050509 Bacteria 14626
165 nmdc:mga0qj67_236492_c1 3300050509 Unclassified 1482
166 nmdc:mga06r32_75225_c1 3300050510 Bacteria 3276
167 nmdc:mga06r32_9069_c1 3300050510 Bacteria 8966
168 nmdc:mga08y16_474165_c1 3300050511 Unclassified 1274
169 nmdc:mga08y16_479795_c1 3300050511 Bacteria 1265
170 nmdc:mga08y16_78076_c1 3300050511 Bacteria 3451
171 nmdc:mga0n895_434816_c1 3300050512 Unclassified 1326
172 nmdc:mga0rr50_117998_c1 3300050513 Bacteria 2108
173 nmdc:mga0rr50_186199_c1 3300050513 Bacteria 1699
174 Ga0501084_0001676 3300054114 Bacteria 17610
175 Ga0590071_071570 3300059421 Bacteria 855
176 Ga0501082_0048084 3300060353 Unclassified 3676
177 Ga0530510_0001283 3300061734 Bacteria 16771
178 Ga0316578_10051862
179 Ga0070658_10076105
180 Ga0070690_100024298
181 Ga0070670_100030257
182 Ga0070670_100275418
183 Ga0070666_10196437
184 Ga0070689_100050010
185 Ga0070689_100154357
186 Ga0070687_100001021
187 Ga0070661_100161941
188 Ga0070669_100177843
189 Ga0070675_100000902
190 Ga0070675_100030257
191 Ga0070674_100907998
192 Ga0070659_100567443
193 Ga0070714_100019876
194 Ga0070705_100038668
195 Ga0070694_100470938
196 Ga0070662_100643951
197 Ga0068867_100459177
198 Ga0070684_100133472
199 Ga0070697_100336121
200 Ga0068853_100850103
201 Ga0070672_100438324
202 Ga0070686_100000416
203 Ga0070695_100250058
204 Ga0070696_100014444
205 Ga0068855_100191313
206 Ga0070664_100127725
207 Ga0068854_100278039
208 Ga0068856_100018706
209 Ga0068856_100359248
210 Ga0068859_100195679
211 Ga0068859_100689022
212 Ga0068863_100564242
213 Ga0068862_100087318
214 Ga0075432_10053411
215 Ga0097621_100004762
216 Ga0068871_100000687
217 Ga0075428_100532349
218 Ga0075430_100002337
219 Ga0075431_100013276
220 Ga0075431_100143472
221 Ga0075431_100389769
222 Ga0075431_100607860
223 Ga0097620_100195695
224 Ga0097620_100689070
225 Ga0075435_100162607
226 Ga0075435_100177427
227 Ga0075435_100316499
228 Ga0111539_10208340
229 Ga0111539_10208832
230 Ga0111539_10282470
231 Ga0111539_10392571
232 Ga0111539_10701769
233 Ga0114129_10015007
234 Ga0114129_10080026
235 Ga0114129_10170790
236 Ga0105248_10089069
237 Ga0105248_10110758
238 Ga0105248_10125394
239 Ga0105248_10141193
240 Ga0105248_10688394
241 Ga0163162_10907628
242 Ga0157372_10536544
243 Ga0157375_10254539
244 Ga0163163_10000048
245 Ga0157380_10005731
246 Ga0157377_10027444
247 Ga0157376_10620925
248 Ga0207688_10122710
249 Ga0207705_10454897
250 Ga0207695_10453848
251 Ga0207649_10093590
252 Ga0207646_10475352
253 Ga0207681_10159151
254 Ga0207681_10343018
255 Ga0207650_10040038
256 Ga0207650_10176652
257 Ga0207659_10000086
258 Ga0207659_10033943
259 Ga0207690_10095872
260 Ga0207706_10635017
261 Ga0207686_10485814
262 Ga0207711_10062548
263 Ga0207711_10075117
264 Ga0207679_10016449
265 Ga0207667_10157865
266 Ga0207667_10615123
267 Ga0207640_10453387
268 Ga0207639_10463186
269 Ga0207708_10228382
270 Ga0207708_10274505
271 Ga0207702_10057529
272 Ga0207702_10202115
273 Ga0207648_10383155
274 Ga0207675_100977382
275 Ga0209974_10048883
276 Ga0268265_10048536
277 Ga0268264_10133644
278 Ga0316578_10079465
279 Ga0307405_10280460
280 Ga0307411_10070019
281 Ga0307415_100599623
282 Ga0373928_0065209
283 Ga0373937_0202887
284 Ga0439431_0034891
285 Ga0439450_109864
286 Ga0439435_0010719
287 Ga0439435_0014227
288 Ga0439444_0013304
289 Ga0451577_0040282
290 Ga0453684_0061127
291 Ga0451576_0031133
292 Ga0495580_0033913
293 Ga0495647_0057037
294 Ga0495613_0445673
295 Ga0495581_0177255
296 Ga0495636_0337547
297 Ga0496100_0947779
298 Ga0496101_0270553
299 Ga0496102_0529904
300 Ga0496103_0252162
301 Ga0496105_0739739
302 Ga0496108_0531649
303 Ga0496110_0197527
304 Ga0496111_0364375
305 Ga0496112_0029712
306 Ga0496112_0074435
307 Ga0496113_0073327
308 Ga0496113_0112347
309 Ga0501032_0185242
310 Ga0501033_0031090
311 Ga0501036_0002691
312 Ga0501038_0023825
313 Ga0501040_0007404
314 Ga0501041_0015709
315 Ga0501042_0038114
316 Ga0501043_0063415
317 Ga0501046_0069051
318 Ga0501048_0023878
319 Ga0501068_0009318
320 Ga0501071_0010985
321 Ga0501072_0061492
322 Ga0501072_0468083
323 Ga0501074_0102415
324 Ga0501074_0126420
325 Ga0501075_0001124
326 Ga0501076_0005964
327 Ga0501076_0451654
328 Ga0501076_0696384
329 Ga0501077_0039339
330 Ga0501079_0089314
331 Ga0501080_0299646
332 Ga0501081_0000152
333 Ga0501081_0688348
334 Ga0501045_0004849
335 nmdc:mga05p37_11132_c1
336 nmdc:mga05p37_27714_c1
337 nmdc:mga05p37_297253_c1
338 nmdc:mga05p37_37140_c1
339 nmdc:mga05p37_395776_c1
340 nmdc:mga09592_153764_c1
341 nmdc:mga0qj67_1968_c1
342 nmdc:mga0qj67_236492_c1
343 nmdc:mga06r32_75225_c1
344 nmdc:mga06r32_9069_c1
345 nmdc:mga08y16_474165_c1
346 nmdc:mga08y16_479795_c1
347 nmdc:mga08y16_78076_c1
348 nmdc:mga0n895_434816_c1
349 nmdc:mga0rr50_117998_c1
350 nmdc:mga0rr50_186199_c1
351 Ga0501084_0001676
352 Ga0590071_071570
353 Ga0501082_0048084
354 Ga0530510_0001283

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7f73-assembly1.cif.gz_B cryo-em structure of human tmem120b 0.317 3 220
8b8j-assembly1.cif.gz_B cryo-em structure of ca2+-bound mtmem16f f518h mutant in digitonin 0.315 2 214
3pja-assembly1.cif.gz_E crystal structure of human c3po complex 0.3074 2 220
8b8j-assembly1.cif.gz_B cryo-em structure of ca2+-bound mtmem16f f518h mutant in digitonin 0.2989 2 214
3pja-assembly1.cif.gz_E crystal structure of human c3po complex 0.2882 2 220
ID Description Score Start End Superfamily
af_P9WPG3_21_202_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.3902 3 215 1.20.120.1760
af_P9WPG3_21_202_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.3804 3 215 1.20.120.1760
5mjyB00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;alix/aip1 like domains 0.329 60 224 1.25.40.280
af_Q8I3M3_1_154_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3233 83 223 1.20.140.150
af_Q9VFY4_1_168_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3195 77 226 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A661AGU3-F1-model_v4 Uncharacterized protein 0.8749 5 108 GO:0016020
AF-A0A535MXG4-F1-model_v4 Uncharacterized protein 0.8572 7 145 GO:0016020
AF-A0A2M7E3V9-F1-model_v4 Uncharacterized protein 0.8529 5 145 GO:0016020
AF-A0A1V5K896-F1-model_v4 Uncharacterized protein 0.8517 7 118 GO:0016020
AF-A0A2H0UYG3-F1-model_v4 EXPERA domain-containing protein 0.848 5 145 GO:0016020

Map