F270377

General Info

Members Datasets Scaffolds Average Seq Length
177 141 354 265

Family's Representative Sequence

Representative Sequence 3300026118|Ga0207675_100432149|Ga0207675_1004321492
Length 314
Sequence MADHKHFMRPAFVISFSPYVEKREMTDESVSGDRKLIQFSCSSWMSAAFDGKLEAVYTHGHHESVLRSHKWRTVQNSAAYLLPHLKPGLQLLDVGCGPGSITADFAQRIGPGSVLGLDASAGIIDAARRDHPGVEFAVGDVYRLAFDDRSWDIVHAHQLLQHVSDPVAALKEMRRVVRPGGVVAARDSDYDTFSWHPHDDRLTRWLALYQEIARANGGEPNAGRRLLSWAQAAGFSQVHASAAVWCFATPEERAWWGGLWADRMTNSAVAQQAQREHRASAEQLTDLANAWRAWAAAPDGWFAVTHGEVICFGS

Samples

Sample ID Description Type Environment
1 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
48 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
49 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
50 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
66 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
67 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
68 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
69 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
70 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
73 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
74 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
75 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
76 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
77 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
78 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
79 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
80 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
81 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
82 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
83 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
84 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
85 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
86 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
87 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
88 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
89 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
90 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
91 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
92 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
95 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
96 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
97 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
98 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
99 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
100 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
101 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
102 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
103 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
104 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
105 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
106 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
107 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
108 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
113 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
114 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
115 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
116 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
117 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
119 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
120 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
121 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
122 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
123 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
124 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
125 2643221553 Microbacterium sp. Root553 Isolate Unclassified
126 2643221630 Microbacterium sp. Root322 Isolate Unclassified
127 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
128 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
129 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
130 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
131 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
132 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
133 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
134 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
135 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
136 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
137 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
138 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
139 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
140 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
141 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.83
Metatranscriptomes 0
Isolates 10.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.95
Nodule 0
Rhizoplane 5.08
Rhizosphere 72.88
Stem 0
Stem Tuber 0
Unclassified 3.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207675_100432149 3300026118 Unclassified 1302
2 Ga0065712_10007537 3300005290 Bacteria 3909
3 Ga0070690_100034458 3300005330 Bacteria 3172
4 Ga0070670_100004729 3300005331 Bacteria 11424
5 Ga0070689_100097769 3300005340 Bacteria 2322
6 Ga0070668_100136806 3300005347 Bacteria 1971
7 Ga0070675_100009341 3300005354 Bacteria 7627
8 Ga0070659_100136421 3300005366 Bacteria 1995
9 Ga0070667_100463685 3300005367 Bacteria 1158
10 Ga0070709_10082690 3300005434 Bacteria 2098
11 Ga0070714_100080499 3300005435 Bacteria 2835
12 Ga0070710_10171317 3300005437 Bacteria 1353
13 Ga0070694_100172313 3300005444 Bacteria 1595
14 Ga0070678_100221834 3300005456 Bacteria 1572
15 Ga0070681_10260632 3300005458 Bacteria 1646
16 Ga0070685_10139197 3300005466 Bacteria 1526
17 Ga0070706_100424436 3300005467 Bacteria 1237
18 Ga0070707_100023219 3300005468 Bacteria 5866
19 Ga0070698_100008589 3300005471 Bacteria 11017
20 Ga0070699_100021306 3300005518 Bacteria 5590
21 Ga0070699_100258380 3300005518 Bacteria 1557
22 Ga0070672_100377275 3300005543 Bacteria 1212
23 Ga0070665_100402119 3300005548 Bacteria 1378
24 Ga0070664_100110292 3300005564 Bacteria 2401
25 Ga0068856_100089859 3300005614 Bacteria 3055
26 Ga0068859_100108819 3300005617 Bacteria 2833
27 Ga0068864_100008075 3300005618 Bacteria 8680
28 Ga0068861_100028905 3300005719 Bacteria 4049
29 Ga0068861_100097337 3300005719 Unclassified 2334
30 Ga0068858_100555538 3300005842 Bacteria 1111
31 Ga0081540_1011382 3300005983 Bacteria 5949
32 Ga0081540_1105946 3300005983 Bacteria 1200
33 Ga0070717_10024763 3300006028 Bacteria 4769
34 Ga0075364_10077627 3300006051 Bacteria 2192
35 Ga0075364_10156299 3300006051 Bacteria 1538
36 Ga0075430_100165875 3300006846 Bacteria 1838
37 Ga0075434_100082403 3300006871 Bacteria 3214
38 Ga0075429_100020587 3300006880 Bacteria 5725
39 Ga0097620_100108819 3300006931 Bacteria 2833
40 Ga0075435_100007990 3300007076 Bacteria 7573
41 Ga0105240_10036096 3300009093 Bacteria 6363
42 Ga0111539_10170507 3300009094 Bacteria 2543
43 Ga0111539_10326187 3300009094 Unclassified 1787
44 Ga0105245_10532101 3300009098 Bacteria 1195
45 Ga0105249_10045906 3300009553 Bacteria 3976
46 Ga0157370_10273512 3300013104 Bacteria 1560
47 Ga0157375_10255599 3300013308 Bacteria 1913
48 Ga0163163_10530934 3300014325 Bacteria 1239
49 Ga0163163_10673390 3300014325 Bacteria 1098
50 Ga0157380_10061418 3300014326 Bacteria 3007
51 Ga0182008_10163731 3300014497 Bacteria 1120
52 Ga0163161_10071993 3300017792 Bacteria 2530
53 Ga0163161_10278912 3300017792 Bacteria 1310
54 Ga0213876_10045521 3300021384 Bacteria 2320
55 Ga0213876_10047188 3300021384 Bacteria 2277
56 Ga0213875_10079919 3300021388 Bacteria 1526
57 Ga0209646_1000041 3300025246 Bacteria 346024
58 Ga0207692_10006129 3300025898 Bacteria 4864
59 Ga0207647_10046884 3300025904 Bacteria 2690
60 Ga0207699_10143690 3300025906 Bacteria 1571
61 Ga0207684_10088785 3300025910 Bacteria 2634
62 Ga0207684_10394907 3300025910 Bacteria 1189
63 Ga0207707_10511340 3300025912 Bacteria 1023
64 Ga0207646_10125949 3300025922 Bacteria 2303
65 Ga0207650_10009721 3300025925 Bacteria 6577
66 Ga0207691_10043941 3300025940 Bacteria 4115
67 Ga0207668_10260710 3300025972 Bacteria 1412
68 Ga0207678_10456072 3300026067 Bacteria 1112
69 Ga0207648_10735032 3300026089 Bacteria 916
70 Ga0207676_10008255 3300026095 Bacteria 7408
71 Ga0207675_100040229 3300026118 Bacteria 4365
72 Ga0207683_10291479 3300026121 Bacteria 1492
73 Ga0268266_10643790 3300028379 Bacteria 1020
74 Ga0268266_10807312 3300028379 Bacteria 906
75 Ga0268264_10272749 3300028381 Bacteria 1581
76 Ga0307517_10033012 3300028786 Bacteria 5962
77 Ga0307515_10340047 3300028794 Bacteria 1154
78 Ga0265338_10027379 3300028800 Bacteria 5719
79 Ga0307408_100590531 3300031548 Bacteria 985
80 Ga0316576_10036132 3300031727 Bacteria 3531
81 Ga0307406_10002182 3300031901 Bacteria 10655
82 Ga0307409_100029128 3300031995 Bacteria 3947
83 Ga0307409_100236736 3300031995 Unclassified 1659
84 Ga0307414_10043575 3300032004 Bacteria 3058
85 Ga0307414_10214168 3300032004 Bacteria 1577
86 Ga0373926_0007429 3300035083 Bacteria 3650
87 Ga0373942_0096349 3300035207 Bacteria 899
88 Ga0373935_0002840 3300035692 Bacteria 9967
89 Ga0373947_0000016 3300035725 Bacteria 124284
90 Ga0436364_0156343 3300037853 Bacteria 855
91 Ga0436364_0240207 3300037853 Bacteria 2469
92 Ga0436364_0833526 3300037853 Bacteria 3151
93 Ga0436364_1384302 3300037853 Bacteria 3564
94 Ga0436365_1627569 3300039437 Bacteria 24179
95 Ga0451791_0797813 3300041451 Bacteria 2160
96 Ga0451837_0144187 3300041494 Bacteria 2860
97 Ga0451853_0378167 3300041512 Bacteria 1691
98 Ga0466969_0023457 3300044656 Bacteria 3180
99 Ga0466969_0206013 3300044656 Bacteria 897
100 Ga0466972_0021075 3300044658 Bacteria 3254
101 Ga0466966_0007218 3300044684 Bacteria 7365
102 Ga0466966_0010294 3300044684 Bacteria 6206
103 Ga0466961_0136962 3300044693 Bacteria 1534
104 Ga0466963_0227090 3300044694 Bacteria 1308
105 Ga0466968_0005414 3300044735 Bacteria 4782
106 Ga0466970_0149137 3300044765 Bacteria 1291
107 Ga0466957_0003725 3300044842 Bacteria 8425
108 Ga0466957_0074361 3300044842 Bacteria 2107
109 Ga0466960_0090376 3300044901 Bacteria 1560
110 Ga0466959_0006119 3300045049 Bacteria 8314
111 Ga0466959_0034597 3300045049 Bacteria 3737
112 Ga0466958_0010186 3300045836 Bacteria 5258
113 Ga0466958_0059768 3300045836 Bacteria 2319
114 Ga0466958_0168532 3300045836 Bacteria 1386
115 Ga0466967_0195836 3300045976 Bacteria 1911
116 Ga0495627_001478 3300046453 Bacteria 13634
117 Ga0495639_0260821 3300046475 Bacteria 858
118 Ga0495598_0026738 3300046537 Bacteria 1585
119 Ga0495669_0009805 3300046684 Bacteria 4045
120 Ga0495600_0310793 3300046809 Bacteria 993
121 Ga0496102_0159516 3300048905 Bacteria 2121
122 Ga0496109_0016042 3300048912 Bacteria 6548
123 Ga0496109_0469067 3300048912 Unclassified 1189
124 Ga0496111_0286943 3300048914 Unclassified 1221
125 Ga0496114_0092571 3300048917 Bacteria 2568
126 Ga0496114_0314666 3300048917 Unclassified 1383
127 Ga0496115_0040341 3300048918 Bacteria 3711
128 Ga0496115_0461481 3300048918 Bacteria 1025
129 Ga0496117_0000823 3300048920 Bacteria 48067
130 Ga0496117_0046387 3300048920 Bacteria 3126
131 Ga0496118_0000185 3300048921 Bacteria 109095
132 Ga0496118_0035614 3300048921 Bacteria 4038
133 Ga0496122_0020365 3300048925 Bacteria 5997
134 Ga0496122_0032674 3300048925 Bacteria 4298
135 Ga0496122_0157157 3300048925 Bacteria 1393
136 Ga0496125_0010540 3300048928 Bacteria 9345
137 Ga0496125_0034331 3300048928 Bacteria 4473
138 Ga0496125_0113648 3300048928 Bacteria 1953
139 Ga0496126_0216556 3300048929 Bacteria 1610
140 Ga0501034_0002990 3300049571 Bacteria 19565
141 Ga0501034_0004347 3300049571 Bacteria 15792
142 Ga0501042_0016168 3300049578 Bacteria 5118
143 Ga0501043_0244907 3300049579 Bacteria 1382
144 Ga0501068_0039350 3300049584 Bacteria 2835
145 Ga0501069_0000584 3300049585 Bacteria 16863
146 Ga0501070_0000016 3300049586 Bacteria 178549
147 Ga0501070_0001455 3300049586 Bacteria 21188
148 Ga0501071_0275158 3300049587 Bacteria 1273
149 Ga0501074_0319322 3300049590 Bacteria 1103
150 Ga0501035_0000753 3300049822 Bacteria 34892
151 Ga0501044_0001677 3300049823 Bacteria 26037
152 nmdc:mga00v17_12409_c1 3300050491 Bacteria 4702
153 nmdc:mga00v17_208537_c1 3300050491 Bacteria 1264
154 nmdc:mga00v17_304445_c1 3300050491 Bacteria 1035
155 nmdc:mga00v17_96366_c1 3300050491 Bacteria 1863
156 nmdc:mga09592_88785_c1 3300050508 Bacteria 2640
157 nmdc:mga08y16_311539_c1 3300050511 Bacteria 1621
158 nmdc:mga0n895_619428_c1 3300050512 Bacteria 1083
159 Ga0500583_0061141 3300053092 Bacteria 1778
160 2643734707 2643221542 Bacteria 3563959
161 2643783628 2643221553 Bacteria 3544260
162 2644172872 2643221630 Bacteria 3601215
163 2644679135 2643221724 Bacteria 3593515
164 2730228633 2728369380 Bacteria 3620317
165 2731907990 2731639228 Bacteria 4187555
166 2747952970 2747842429 Bacteria 3914386
167 2837275697 2837268691 Bacteria 7850704
168 2852666039 2852663356 Bacteria 4090475
169 2857724542 2857723135 Bacteria 4217853
170 2887479865 2887478801 Bacteria 8972725
171 2946034866 2946033335 Bacteria 3835514
172 2946043038 2946041624 Bacteria 4191385
173 2946081927 2946080515 Bacteria 4310960
174 2966927166 2966924647 Bacteria 3268643
175 3006427142 3006425503 Bacteria 6491253
176 8004183420 8004182704 Bacteria 3391155
177 8004212899 8004212874 Bacteria 2861420
178 Ga0207675_100432149
179 Ga0065712_10007537
180 Ga0070690_100034458
181 Ga0070670_100004729
182 Ga0070689_100097769
183 Ga0070668_100136806
184 Ga0070675_100009341
185 Ga0070659_100136421
186 Ga0070667_100463685
187 Ga0070709_10082690
188 Ga0070714_100080499
189 Ga0070710_10171317
190 Ga0070694_100172313
191 Ga0070678_100221834
192 Ga0070681_10260632
193 Ga0070685_10139197
194 Ga0070706_100424436
195 Ga0070707_100023219
196 Ga0070698_100008589
197 Ga0070699_100021306
198 Ga0070699_100258380
199 Ga0070672_100377275
200 Ga0070665_100402119
201 Ga0070664_100110292
202 Ga0068856_100089859
203 Ga0068859_100108819
204 Ga0068864_100008075
205 Ga0068861_100028905
206 Ga0068861_100097337
207 Ga0068858_100555538
208 Ga0081540_1011382
209 Ga0081540_1105946
210 Ga0070717_10024763
211 Ga0075364_10077627
212 Ga0075364_10156299
213 Ga0075430_100165875
214 Ga0075434_100082403
215 Ga0075429_100020587
216 Ga0097620_100108819
217 Ga0075435_100007990
218 Ga0105240_10036096
219 Ga0111539_10170507
220 Ga0111539_10326187
221 Ga0105245_10532101
222 Ga0105249_10045906
223 Ga0157370_10273512
224 Ga0157375_10255599
225 Ga0163163_10530934
226 Ga0163163_10673390
227 Ga0157380_10061418
228 Ga0182008_10163731
229 Ga0163161_10071993
230 Ga0163161_10278912
231 Ga0213876_10045521
232 Ga0213876_10047188
233 Ga0213875_10079919
234 Ga0209646_1000041
235 Ga0207692_10006129
236 Ga0207647_10046884
237 Ga0207699_10143690
238 Ga0207684_10088785
239 Ga0207684_10394907
240 Ga0207707_10511340
241 Ga0207646_10125949
242 Ga0207650_10009721
243 Ga0207691_10043941
244 Ga0207668_10260710
245 Ga0207678_10456072
246 Ga0207648_10735032
247 Ga0207676_10008255
248 Ga0207675_100040229
249 Ga0207683_10291479
250 Ga0268266_10643790
251 Ga0268266_10807312
252 Ga0268264_10272749
253 Ga0307517_10033012
254 Ga0307515_10340047
255 Ga0265338_10027379
256 Ga0307408_100590531
257 Ga0316576_10036132
258 Ga0307406_10002182
259 Ga0307409_100029128
260 Ga0307409_100236736
261 Ga0307414_10043575
262 Ga0307414_10214168
263 Ga0373926_0007429
264 Ga0373942_0096349
265 Ga0373935_0002840
266 Ga0373947_0000016
267 Ga0436364_0156343
268 Ga0436364_0240207
269 Ga0436364_0833526
270 Ga0436364_1384302
271 Ga0436365_1627569
272 Ga0451791_0797813
273 Ga0451837_0144187
274 Ga0451853_0378167
275 Ga0466969_0023457
276 Ga0466969_0206013
277 Ga0466972_0021075
278 Ga0466966_0007218
279 Ga0466966_0010294
280 Ga0466961_0136962
281 Ga0466963_0227090
282 Ga0466968_0005414
283 Ga0466970_0149137
284 Ga0466957_0003725
285 Ga0466957_0074361
286 Ga0466960_0090376
287 Ga0466959_0006119
288 Ga0466959_0034597
289 Ga0466958_0010186
290 Ga0466958_0059768
291 Ga0466958_0168532
292 Ga0466967_0195836
293 Ga0495627_001478
294 Ga0495639_0260821
295 Ga0495598_0026738
296 Ga0495669_0009805
297 Ga0495600_0310793
298 Ga0496102_0159516
299 Ga0496109_0016042
300 Ga0496109_0469067
301 Ga0496111_0286943
302 Ga0496114_0092571
303 Ga0496114_0314666
304 Ga0496115_0040341
305 Ga0496115_0461481
306 Ga0496117_0000823
307 Ga0496117_0046387
308 Ga0496118_0000185
309 Ga0496118_0035614
310 Ga0496122_0020365
311 Ga0496122_0032674
312 Ga0496122_0157157
313 Ga0496125_0010540
314 Ga0496125_0034331
315 Ga0496125_0113648
316 Ga0496126_0216556
317 Ga0501034_0002990
318 Ga0501034_0004347
319 Ga0501042_0016168
320 Ga0501043_0244907
321 Ga0501068_0039350
322 Ga0501069_0000584
323 Ga0501070_0000016
324 Ga0501070_0001455
325 Ga0501071_0275158
326 Ga0501074_0319322
327 Ga0501035_0000753
328 Ga0501044_0001677
329 nmdc:mga00v17_12409_c1
330 nmdc:mga00v17_208537_c1
331 nmdc:mga00v17_304445_c1
332 nmdc:mga00v17_96366_c1
333 nmdc:mga09592_88785_c1
334 nmdc:mga08y16_311539_c1
335 nmdc:mga0n895_619428_c1
336 Ga0500583_0061141
337 2643734707
338 2643783628
339 2644172872
340 2644679135
341 2730228633
342 2731907990
343 2747952970
344 2837275697
345 2852666039
346 2857724542
347 2887479865
348 2946034866
349 2946043038
350 2946081927
351 2966927166
352 3006427142
353 8004183420
354 8004212899

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13649

Methyltransf_25

Methyltransferase domain

91

181

0.96

PF08241

Methyltransf_11

Methyltransferase domain

92

185

0.95

PF08242

Methyltransf_12

Methyltransferase domain

92

183

0.93

PF13847

Methyltransf_31

Methyltransferase domain

85

234

0.87

PF01728

FtsJ

FtsJ-like methyltransferase

78

177

0.87

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

56

192

0.86

PF13489

Methyltransf_23

Methyltransferase domain

66

240

0.81

PF07021

MetW

Methionine biosynthesis protein MetW

75

187

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mgg-assembly1.cif.gz_A crystal structure of methyl transferase from methanosarcina mazei 0.8861 40 265
5cm2-assembly1.cif.gz_Z structure of y. lipolytica trm9-trm112 complex, a methyltransferase modifying u34 in the anticodon loop of some trnas 0.826 31 151
3mgg-assembly1.cif.gz_A crystal structure of methyl transferase from methanosarcina mazei 0.8152 40 265
7wzg-assembly1.cif.gz_F cypemycin n-terminal methyltransferase cypm 0.8015 18 150
4qpn-assembly1.cif.gz_A crystal structure of human methyltransferase-like protein 21b 0.7992 40 140
ID Description Score Start End Superfamily
af_I6X9X6_5_255_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9869 7 250 3.40.50.150
af_I6X9X6_5_255_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9558 7 250 3.40.50.150
af_A0A0R0FLG0_1_109_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.947 33 82 3.40.50.150
af_O01594_147_310_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9219 40 138 3.40.50.150
af_O13871_19_175_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9066 20 163 3.40.50.150
ID Description Score Start End GO Terms
AF-D6K6A3-F1-model_v4 UbiE/COQ5 family methyltransferase 0.9842 113 265 GO:0008757
GO:0032259
AF-A0A2V7AMJ5-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9796 1 265 GO:0008757
GO:0016020
AF-A0A382CM38-F1-model_v4 Methyltransferase domain-containing protein 0.9791 7 235 GO:0010420
AF-A0A2V6WQ22-F1-model_v4 SAM-dependent methyltransferase 0.979 120 265
AF-A0A175WE67-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9783 112 265

Map