F269777

General Info

Members Datasets Scaffolds Average Seq Length
177 78 176 557

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100140944|Ga0070706_1001409441
Length 576
Sequence MTSPASVRLKSERRAAAQRWRSRLRLWSGCVLFLYVTLHLANHALGLISLDAMQAGRVWFVGLWRNPLGTAALYTSLVVHPLLALWSLYRRRTLRMPAWEATQVLLGLAIPPLLAAHIVGTRLAYEWYGQVDSYPRVVLSLWELRPVAGVRQATVLTIAWLHGCVGLHFWLRLRPWYPRVVPWLFATALLLPVLALLGFAHAGGEAAALARQPGGTARLLQQNPRLGAEERQTLIRVEWGLYAGFTAALGLTLLARAGRRFYVRRWRAIRITYPGGREIAVPAGFSILEASRFAQIPHASVCGGRGRCSTCRVQILRGGEAIPAPSADERRVLKRVGVPPSVRLACQARPTGDVVVKPLLPATARASDGFSRPRTLAGAEQEITVLFADLRKFTALAEHRLPYDVVFFLNRYFEAVGGAIERAGGITNQFTGDGVMALFGVDADPGDGCRRALLGAQAMVEGVAHLSRTMADELDEPLRIGIGIHTGPAVVGRMGYGSTVYLTAVGDTVHVASRFQDLTKQYQAQLVISEQVAERAGIDVSTFPRHETTVRNRREPLAIRVIADVAALDLGHVAPR

Samples

Sample ID Description Type Environment
1 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
2 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
3 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
4 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
5 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
6 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
7 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
10 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
13 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
14 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
17 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
26 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
32 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
33 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
34 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
40 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
41 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
42 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
43 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
44 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
45 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
46 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
47 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
48 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
49 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
50 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
51 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
52 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
53 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
54 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
55 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
56 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
57 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
58 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
59 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
60 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
61 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
62 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
63 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
64 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
65 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
66 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
67 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
68 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
69 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
70 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
71 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
72 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
73 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
74 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
75 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
76 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
77 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
78 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0
Isolates 0.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.69
Rhizosphere 96.61
Stem 0
Stem Tuber 0
Unclassified 1.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_100043643 3300005353 Bacteria 3267
2 Ga0070694_100014711 3300005444 Bacteria 4902
3 Ga0070708_100056718 3300005445 Bacteria 3485
4 Ga0070662_100053119 3300005457 Bacteria 2932
5 Ga0070706_100082803 3300005467 Bacteria 2972
6 Ga0070706_100097631 3300005467 Unclassified 2729
7 Ga0070706_100140944 3300005467 Bacteria 2251
8 Ga0070707_100010005 3300005468 Bacteria 8825
9 Ga0070707_100029566 3300005468 Bacteria 5216
10 Ga0070707_100045566 3300005468 Bacteria 4197
11 Ga0070707_100049997 3300005468 Bacteria 4007
12 Ga0070698_100140476 3300005471 Bacteria 2366
13 Ga0070699_100066194 3300005518 Bacteria 3136
14 Ga0070697_100002539 3300005536 Bacteria 14044
15 Ga0070697_100031562 3300005536 Bacteria 4262
16 Ga0070697_100091355 3300005536 Bacteria 2517
17 Ga0070697_100124757 3300005536 Bacteria 2156
18 Ga0068853_100009237 3300005539 Bacteria 7945
19 Ga0070695_100020114 3300005545 Bacteria 4072
20 Ga0070696_100056699 3300005546 Bacteria 2733
21 Ga0070704_100027631 3300005549 Bacteria 3766
22 Ga0070704_100105709 3300005549 Bacteria 2132
23 Ga0068857_100008445 3300005577 Bacteria 8901
24 Ga0068857_100021695 3300005577 Bacteria 5651
25 Ga0068862_100013157 3300005844 Bacteria 6844
26 Ga0081538_10008784 3300005981 Bacteria 8517
27 Ga0081539_10000266 3300005985 Bacteria 119926
28 Ga0070712_100087425 3300006175 Unclassified 2274
29 Ga0075428_100000848 3300006844 Bacteria 32123
30 Ga0075428_100003341 3300006844 Bacteria 17560
31 Ga0075428_100003417 3300006844 Bacteria 17368
32 Ga0075428_100029811 3300006844 Bacteria 6035
33 Ga0075428_100058249 3300006844 Bacteria 4229
34 Ga0075430_100002624 3300006846 Bacteria 15023
35 Ga0075430_100004942 3300006846 Bacteria 11215
36 Ga0075430_100012140 3300006846 Bacteria 7335
37 Ga0075430_100022683 3300006846 Bacteria 5341
38 Ga0075430_100048462 3300006846 Bacteria 3587
39 Ga0075431_100000212 3300006847 Bacteria 42845
40 Ga0075431_100003922 3300006847 Bacteria 14486
41 Ga0075431_100008484 3300006847 Bacteria 10291
42 Ga0075431_100017254 3300006847 Bacteria 7335
43 Ga0075431_100025801 3300006847 Bacteria 6024
44 Ga0075433_10000872 3300006852 Bacteria 21150
45 Ga0075433_10002127 3300006852 Bacteria 15009
46 Ga0075433_10002548 3300006852 Bacteria 13886
47 Ga0075433_10102759 3300006852 Bacteria 2531
48 Ga0075434_100001673 3300006871 Bacteria 18919
49 Ga0075434_100004651 3300006871 Bacteria 12403
50 Ga0075434_100007908 3300006871 Bacteria 9854
51 Ga0075434_100013139 3300006871 Bacteria 7865
52 Ga0075434_100023394 3300006871 Bacteria 6020
53 Ga0075434_100063924 3300006871 Bacteria 3663
54 Ga0075434_100129278 3300006871 Unclassified 2544
55 Ga0075429_100008033 3300006880 Bacteria 9170
56 Ga0075429_100012130 3300006880 Bacteria 7468
57 Ga0075429_100018879 3300006880 Bacteria 5974
58 Ga0075429_100018966 3300006880 Bacteria 5959
59 Ga0075435_100003503 3300007076 Bacteria 10650
60 Ga0075435_100007585 3300007076 Bacteria 7747
61 Ga0075435_100016884 3300007076 Bacteria 5510
62 Ga0075435_100084994 3300007076 Bacteria 2604
63 Ga0111539_10002448 3300009094 Bacteria 24679
64 Ga0111539_10007696 3300009094 Bacteria 13757
65 Ga0111539_10055221 3300009094 Bacteria 4722
66 Ga0111539_10058958 3300009094 Bacteria 4554
67 Ga0111539_10124412 3300009094 Bacteria 3022
68 Ga0111539_10304519 3300009094 Bacteria 1854
69 Ga0114129_10001886 3300009147 Bacteria 28603
70 Ga0114129_10002069 3300009147 Bacteria 27568
71 Ga0114129_10002145 3300009147 Bacteria 27198
72 Ga0114129_10018241 3300009147 Bacteria 9992
73 Ga0114129_10042295 3300009147 Bacteria 6416
74 Ga0114129_10064585 3300009147 Bacteria 5109
75 Ga0114129_10071714 3300009147 Bacteria 4830
76 Ga0114129_10072486 3300009147 Bacteria 4801
77 Ga0114129_10204216 3300009147 Bacteria 2674
78 Ga0114129_10231940 3300009147 Bacteria 2486
79 Ga0105241_10014858 3300009174 Bacteria 5700
80 Ga0105242_10017119 3300009176 Bacteria 5644
81 Ga0163162_10007035 3300013306 Bacteria 10910
82 Ga0213872_10001025 3300021361 Bacteria 19492
83 Ga0213872_10028492 3300021361 Bacteria 2561
84 Ga0213876_10028053 3300021384 Bacteria 2968
85 Ga0207684_10067628 3300025910 Bacteria 3036
86 Ga0207693_10106335 3300025915 Unclassified 2201
87 Ga0207646_10014046 3300025922 Bacteria 7617
88 Ga0207706_10028050 3300025933 Bacteria 5030
89 Ga0207674_10006290 3300026116 Bacteria 13992
90 Ga0207674_10039827 3300026116 Bacteria 4870
91 Ga0207428_10002515 3300027907 Bacteria 18299
92 Ga0207428_10004633 3300027907 Bacteria 13031
93 Ga0207428_10135835 3300027907 Bacteria 1880
94 Ga0307410_10013458 3300031852 Bacteria 4775
95 Ga0307409_100005811 3300031995 Bacteria 7157
96 Ga0307416_100063850 3300032002 Bacteria 3018
97 Ga0307411_10010910 3300032005 Bacteria 4872
98 Ga0307411_10023159 3300032005 Bacteria 3673
99 Ga0307415_100015287 3300032126 Bacteria 4539
100 Ga0373940_0003474 3300035088 Bacteria 3221
101 Ga0373931_0002177 3300035691 Bacteria 8639
102 Ga0436365_0209853 3300039437 Bacteria 16640
103 Ga0436361_0633541 3300039447 Bacteria 10765
104 Ga0436361_0883944 3300039447 Bacteria 33849
105 Ga0451577_0001905 3300042876 Bacteria 26449
106 Ga0453684_0013361 3300044712 Bacteria 13350
107 Ga0451576_0003527 3300045051 Bacteria 21348
108 Ga0451576_0025602 3300045051 Bacteria 6355
109 Ga0451576_0203735 3300045051 Bacteria 2066
110 Ga0495580_0000458 3300046472 Bacteria 33798
111 Ga0495580_0002980 3300046472 Bacteria 14526
112 Ga0496102_0025411 3300048905 Bacteria 5272
113 Ga0496103_0110640 3300048906 Bacteria 1745
114 Ga0496105_0002387 3300048908 Bacteria 13605
115 Ga0501031_0029909 3300049568 Bacteria 3553
116 Ga0501034_0067146 3300049571 Bacteria 3600
117 Ga0501040_0115797 3300049576 Bacteria 1877
118 Ga0501048_0049472 3300049582 Bacteria 2995
119 Ga0501067_0008739 3300049583 Bacteria 5613
120 Ga0501072_0001090 3300049588 Bacteria 20179
121 Ga0501075_0006119 3300049591 Bacteria 8269
122 Ga0501077_0004621 3300049593 Bacteria 8361
123 Ga0501077_0013215 3300049593 Bacteria 5174
124 Ga0501216_002509 3300049660 Bacteria 2614
125 Ga0501225_0020901 3300049705 Unclassified 1809
126 Ga0501079_0006942 3300049741 Bacteria 8534
127 Ga0501081_0012147 3300049743 Bacteria 5648
128 Ga0501081_0046515 3300049743 Bacteria 2983
129 Ga0501081_0051773 3300049743 Bacteria 2832
130 nmdc:mga05p37_113786_c1 3300050507 Bacteria 3327
131 nmdc:mga05p37_17337_c1 3300050507 Bacteria 8688
132 nmdc:mga05p37_20879_c1 3300050507 Bacteria 7927
133 nmdc:mga05p37_224547_c1 3300050507 Bacteria 2265
134 nmdc:mga05p37_23017_c1 3300050507 Bacteria 7558
135 nmdc:mga05p37_43593_c1 3300050507 Bacteria 5519
136 nmdc:mga05p37_52366_c1 3300050507 Bacteria 5019
137 nmdc:mga09592_1207_c1 3300050508 Bacteria 20717
138 nmdc:mga09592_23070_c1 3300050508 Bacteria 5137
139 nmdc:mga09592_2845_c1 3300050508 Bacteria 14039
140 nmdc:mga0qj67_12628_c1 3300050509 Bacteria 6367
141 nmdc:mga0qj67_30202_c1 3300050509 Bacteria 4216
142 nmdc:mga0qj67_42638_c1 3300050509 Bacteria 3572
143 nmdc:mga06r32_125000_c1 3300050510 Bacteria 2539
144 nmdc:mga06r32_141742_c1 3300050510 Bacteria 2380
145 nmdc:mga06r32_14291_c1 3300050510 Bacteria 7201
146 nmdc:mga06r32_1929_c1 3300050510 Bacteria 18484
147 nmdc:mga06r32_270_c1 3300050510 Bacteria 43060
148 nmdc:mga06r32_29221_c1 3300050510 Bacteria 5164
149 nmdc:mga06r32_4171_c1 3300050510 Bacteria 12943
150 nmdc:mga08y16_124565_c1 3300050511 Bacteria 2681
151 nmdc:mga08y16_149816_c1 3300050511 Bacteria 2425
152 nmdc:mga08y16_1648_c1 3300050511 Bacteria 22611
153 nmdc:mga08y16_3352_c1 3300050511 Bacteria 16592
154 nmdc:mga08y16_82128_c1 3300050511 Bacteria 3360
155 nmdc:mga0n895_104698_c1 3300050512 Bacteria 2842
156 nmdc:mga0n895_109580_c1 3300050512 Unclassified 2776
157 nmdc:mga0n895_12027_c1 3300050512 Bacteria 7747
158 nmdc:mga0n895_124393_c1 3300050512 Bacteria 2602
159 nmdc:mga0n895_168292_c1 3300050512 Bacteria 2224
160 nmdc:mga0n895_2300_c1 3300050512 Bacteria 14853
161 nmdc:mga0n895_46490_c1 3300050512 Bacteria 4241
162 nmdc:mga0rr50_42671_c1 3300050513 Bacteria 3314
163 nmdc:mga0rr50_51638_c1 3300050513 Bacteria 3052
164 nmdc:mga08x19_29915_c1 3300050514 Bacteria 3418
165 nmdc:mga08x19_51705_c1 3300050514 Bacteria 2640
166 nmdc:mga0a205_109297_c1 3300050515 Bacteria 2663
167 nmdc:mga0a205_165668_c1 3300050515 Bacteria 2106
168 nmdc:mga0a205_175295_c1 3300050515 Bacteria 2040
169 nmdc:mga0a205_647_c1 3300050515 Bacteria 21360
170 nmdc:mga0a205_71184_c1 3300050515 Bacteria 3358
171 nmdc:mga0a205_741_c1 3300050515 Bacteria 26296
172 nmdc:mga0a205_7482_c1 3300050515 Bacteria 9890
173 nmdc:mga0a205_82102_c1 3300050515 Bacteria 3113
174 nmdc:mga0a205_9794_c1 3300050515 Bacteria 8787
175 Ga0501084_0006367 3300054114 Bacteria 9695
176 Ga0530510_0001911 3300061734 Bacteria 14247

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049582 Ga0501048_0049472 Ga0501048_0049472_451_2190 508
2 3300050511 nmdc:mga08y16_124565_c1 nmdc:mga08y16_124565_c1_1037_2635 511
3 3300049576 Ga0501040_0115797 Ga0501040_0115797_13_1602 518
4 3300050514 nmdc:mga08x19_51705_c1 nmdc:mga08x19_51705_c1_1042_2613 519
5 3300009147 Ga0114129_10064585 Ga0114129_100645854 520
6 3300050507 nmdc:mga05p37_17337_c1 nmdc:mga05p37_17337_c1_4942_6597 520
7 3300050508 nmdc:mga09592_1207_c1 nmdc:mga09592_1207_c1_11644_13299 520
8 3300050510 nmdc:mga06r32_4171_c1 nmdc:mga06r32_4171_c1_2792_4447 520
9 3300021361 Ga0213872_10028492 Ga0213872_100284922 521
10 3300039447 Ga0436361_0633541 Ga0436361_0633541_430_2142 521
11 3300049743 Ga0501081_0046515 Ga0501081_0046515_384_2075 521
12 3300049568 Ga0501031_0029909 Ga0501031_0029909_1114_2853 525
13 3300049593 Ga0501077_0004621 Ga0501077_0004621_367_2106 525
14 3300049705 Ga0501225_0020901 Ga0501225_0020901_168_1790 525
15 3300049741 Ga0501079_0006942 Ga0501079_0006942_4325_6064 525
16 3300006844 Ga0075428_100003417 Ga0075428_10000341716 528
17 3300006846 Ga0075430_100012140 Ga0075430_1000121403 528
18 3300006847 Ga0075431_100017254 Ga0075431_1000172543 528
19 3300006880 Ga0075429_100008033 Ga0075429_1000080335 528
20 3300009147 Ga0114129_10231940 Ga0114129_102319402 528
21 3300050507 nmdc:mga05p37_43593_c1 nmdc:mga05p37_43593_c1_3386_5053 528
22 3300006844 Ga0075428_100029811 Ga0075428_1000298112 530
23 3300006846 Ga0075430_100022683 Ga0075430_1000226836 530
24 3300006847 Ga0075431_100025801 Ga0075431_1000258017 530
25 3300009147 Ga0114129_10072486 Ga0114129_100724864 530
26 3300050510 nmdc:mga06r32_29221_c1 nmdc:mga06r32_29221_c1_2746_4407 530
27 3300049583 Ga0501067_0008739 Ga0501067_0008739_1371_3038 531
28 iso_pu_bacteria 2894817345 2894821930 533
29 3300006880 Ga0075429_100018879 Ga0075429_1000188792 534
30 3300005539 Ga0068853_100009237 Ga0068853_10000923710 535
31 3300005577 Ga0068857_100008445 Ga0068857_1000084456 535
32 3300021361 Ga0213872_10001025 Ga0213872_100010254 535
33 3300026116 Ga0207674_10006290 Ga0207674_100062904 535
34 3300039447 Ga0436361_0883944 Ga0436361_0883944_19932_21659 535
35 3300061734 Ga0530510_0001911 Ga0530510_0001911_9743_11479 536
36 3300049660 Ga0501216_002509 Ga0501216_002509_764_2470 537
37 3300049743 Ga0501081_0051773 Ga0501081_0051773_1002_2696 538
38 3300009094 Ga0111539_10058958 Ga0111539_100589583 539
39 3300021384 Ga0213876_10028053 Ga0213876_100280533 539
40 3300039437 Ga0436365_0209853 Ga0436365_0209853_2637_4298 539
41 3300048906 Ga0496103_0110640 Ga0496103_0110640_55_1704 539
42 3300050511 nmdc:mga08y16_149816_c1 nmdc:mga08y16_149816_c1_256_1974 539
43 3300005546 Ga0070696_100056699 Ga0070696_1000566992 540
44 3300005985 Ga0081539_10000266 Ga0081539_1000026612 542
45 3300006871 Ga0075434_100129278 Ga0075434_1001292781 542
46 3300009147 Ga0114129_10018241 Ga0114129_100182412 542
47 3300050507 nmdc:mga05p37_23017_c1 nmdc:mga05p37_23017_c1_3106_4809 542
48 3300050510 nmdc:mga06r32_125000_c1 nmdc:mga06r32_125000_c1_816_2519 542
49 3300050512 nmdc:mga0n895_109580_c1 nmdc:mga0n895_109580_c1_95_1798 542
50 3300048908 Ga0496105_0002387 Ga0496105_0002387_6666_8351 544
51 3300050510 nmdc:mga06r32_141742_c1 nmdc:mga06r32_141742_c1_66_1763 546
52 3300032005 Ga0307411_10023159 Ga0307411_100231592 547
53 3300050515 nmdc:mga0a205_71184_c1 nmdc:mga0a205_71184_c1_1036_2754 547
54 3300006852 Ga0075433_10002548 Ga0075433_100025489 548
55 3300006871 Ga0075434_100007908 Ga0075434_1000079082 548
56 3300009094 Ga0111539_10304519 Ga0111539_103045191 548
57 3300027907 Ga0207428_10135835 Ga0207428_101358352 548
58 3300050512 nmdc:mga0n895_2300_c1 nmdc:mga0n895_2300_c1_10212_11930 548
59 3300050515 nmdc:mga0a205_9794_c1 nmdc:mga0a205_9794_c1_3701_5419 548
60 3300005444 Ga0070694_100014711 Ga0070694_1000147111 549
61 3300005549 Ga0070704_100027631 Ga0070704_1000276312 549
62 3300006844 Ga0075428_100003341 Ga0075428_10000334114 549
63 3300006846 Ga0075430_100048462 Ga0075430_1000484622 549
64 3300006880 Ga0075429_100012130 Ga0075429_1000121308 549
65 3300006880 Ga0075429_100018966 Ga0075429_1000189662 549
66 3300009094 Ga0111539_10124412 Ga0111539_101244122 549
67 3300009147 Ga0114129_10001886 Ga0114129_1000188625 549
68 3300009147 Ga0114129_10042295 Ga0114129_100422952 549
69 3300035691 Ga0373931_0002177 Ga0373931_0002177_2885_4564 549
70 3300048905 Ga0496102_0025411 Ga0496102_0025411_805_2484 549
71 3300050507 nmdc:mga05p37_113786_c1 nmdc:mga05p37_113786_c1_1082_2737 549
72 3300050508 nmdc:mga09592_2845_c1 nmdc:mga09592_2845_c1_419_2140 549
73 3300050509 nmdc:mga0qj67_30202_c1 nmdc:mga0qj67_30202_c1_1542_3263 549
74 3300050509 nmdc:mga0qj67_42638_c1 nmdc:mga0qj67_42638_c1_588_2309 549
75 3300050510 nmdc:mga06r32_14291_c1 nmdc:mga06r32_14291_c1_2604_4271 549
76 3300050514 nmdc:mga08x19_29915_c1 nmdc:mga08x19_29915_c1_592_2247 549
77 3300050515 nmdc:mga0a205_165668_c1 nmdc:mga0a205_165668_c1_201_1856 549
78 3300050515 nmdc:mga0a205_175295_c1 nmdc:mga0a205_175295_c1_355_2010 549
79 3300006844 Ga0075428_100000848 Ga0075428_1000008487 550
80 3300006847 Ga0075431_100008484 Ga0075431_1000084848 550
81 3300009147 Ga0114129_10002145 Ga0114129_1000214511 550
82 3300049588 Ga0501072_0001090 Ga0501072_0001090_17831_19525 550
83 3300049591 Ga0501075_0006119 Ga0501075_0006119_5232_6926 550
84 3300049593 Ga0501077_0013215 Ga0501077_0013215_601_2295 550
85 3300049743 Ga0501081_0012147 Ga0501081_0012147_304_1998 550
86 3300050507 nmdc:mga05p37_20879_c1 nmdc:mga05p37_20879_c1_4743_6440 550
87 3300054114 Ga0501084_0006367 Ga0501084_0006367_6899_8593 550
88 3300009147 Ga0114129_10002069 Ga0114129_1000206930 551
89 3300050508 nmdc:mga09592_23070_c1 nmdc:mga09592_23070_c1_2259_3962 551
90 3300050512 nmdc:mga0n895_12027_c1 nmdc:mga0n895_12027_c1_619_2322 551
91 3300050515 nmdc:mga0a205_741_c1 nmdc:mga0a205_741_c1_2670_4373 551
92 3300005549 Ga0070704_100105709 Ga0070704_1001057092 552
93 3300005467 Ga0070706_100097631 Ga0070706_1000976312 553
94 3300006871 Ga0075434_100004651 Ga0075434_10000465110 553
95 3300007076 Ga0075435_100007585 Ga0075435_1000075858 553
96 3300031852 Ga0307410_10013458 Ga0307410_100134583 553
97 3300031995 Ga0307409_100005811 Ga0307409_1000058112 553
98 3300032002 Ga0307416_100063850 Ga0307416_1000638501 553
99 3300032005 Ga0307411_10010910 Ga0307411_100109103 553
100 3300032126 Ga0307415_100015287 Ga0307415_1000152874 553
101 3300035088 Ga0373940_0003474 Ga0373940_0003474_829_2502 553
102 3300046472 Ga0495580_0000458 Ga0495580_0000458_5675_7348 553
103 3300046472 Ga0495580_0002980 Ga0495580_0002980_3736_5418 553
104 3300005445 Ga0070708_100056718 Ga0070708_1000567182 554
105 3300005467 Ga0070706_100082803 Ga0070706_1000828032 554
106 3300005468 Ga0070707_100029566 Ga0070707_1000295663 554
107 3300005468 Ga0070707_100049997 Ga0070707_1000499973 554
108 3300005471 Ga0070698_100140476 Ga0070698_1001404761 554
109 3300005518 Ga0070699_100066194 Ga0070699_1000661942 554
110 3300005536 Ga0070697_100002539 Ga0070697_1000025392 554
111 3300005536 Ga0070697_100031562 Ga0070697_1000315623 554
112 3300005536 Ga0070697_100091355 Ga0070697_1000913551 554
113 3300006844 Ga0075428_100058249 Ga0075428_1000582492 554
114 3300006846 Ga0075430_100004942 Ga0075430_1000049424 554
115 3300009094 Ga0111539_10007696 Ga0111539_100076965 554
116 3300009094 Ga0111539_10055221 Ga0111539_100552212 554
117 3300025910 Ga0207684_10067628 Ga0207684_100676282 554
118 3300027907 Ga0207428_10002515 Ga0207428_1000251512 554
119 3300045051 Ga0451576_0203735 Ga0451576_0203735_69_1775 554
120 3300050511 nmdc:mga08y16_3352_c1 nmdc:mga08y16_3352_c1_9819_11525 554
121 3300050511 nmdc:mga08y16_82128_c1 nmdc:mga08y16_82128_c1_681_2369 554
122 3300005457 Ga0070662_100053119 Ga0070662_1000531194 555
123 3300005844 Ga0068862_100013157 Ga0068862_1000131573 555
124 3300006846 Ga0075430_100002624 Ga0075430_1000026244 555
125 3300006847 Ga0075431_100003922 Ga0075431_1000039228 555
126 3300009094 Ga0111539_10002448 Ga0111539_1000244819 555
127 3300009147 Ga0114129_10204216 Ga0114129_102042162 555
128 3300025933 Ga0207706_10028050 Ga0207706_100280504 555
129 3300027907 Ga0207428_10004633 Ga0207428_100046338 555
130 3300042876 Ga0451577_0001905 Ga0451577_0001905_5829_7544 555
131 3300044712 Ga0453684_0013361 Ga0453684_0013361_5761_7476 555
132 3300045051 Ga0451576_0003527 Ga0451576_0003527_15024_16739 555
133 3300049571 Ga0501034_0067146 Ga0501034_0067146_48_1757 555
134 3300050507 nmdc:mga05p37_224547_c1 nmdc:mga05p37_224547_c1_65_1780 555
135 3300050509 nmdc:mga0qj67_12628_c1 nmdc:mga0qj67_12628_c1_4345_6012 555
136 3300050510 nmdc:mga06r32_1929_c1 nmdc:mga06r32_1929_c1_4608_6275 555
137 3300050511 nmdc:mga08y16_1648_c1 nmdc:mga08y16_1648_c1_16961_18676 555
138 3300050512 nmdc:mga0n895_104698_c1 nmdc:mga0n895_104698_c1_1059_2774 555
139 3300050515 nmdc:mga0a205_7482_c1 nmdc:mga0a205_7482_c1_863_2578 555
140 3300005353 Ga0070669_100043643 Ga0070669_1000436432 556
141 3300005467 Ga0070706_100140944 Ga0070706_1001409441 556
142 3300005468 Ga0070707_100010005 Ga0070707_1000100054 556
143 3300005468 Ga0070707_100045566 Ga0070707_1000455663 556
144 3300005536 Ga0070697_100124757 Ga0070697_1001247572 556
145 3300005545 Ga0070695_100020114 Ga0070695_1000201143 556
146 3300005577 Ga0068857_100021695 Ga0068857_1000216952 556
147 3300005981 Ga0081538_10008784 Ga0081538_100087842 556
148 3300006175 Ga0070712_100087425 Ga0070712_1000874252 556
149 3300006847 Ga0075431_100000212 Ga0075431_1000002121 556
150 3300006852 Ga0075433_10000872 Ga0075433_100008728 556
151 3300006852 Ga0075433_10002127 Ga0075433_100021274 556
152 3300006852 Ga0075433_10102759 Ga0075433_101027592 556
153 3300006871 Ga0075434_100001673 Ga0075434_1000016735 556
154 3300006871 Ga0075434_100013139 Ga0075434_1000131395 556
155 3300006871 Ga0075434_100023394 Ga0075434_1000233942 556
156 3300006871 Ga0075434_100063924 Ga0075434_1000639243 556
157 3300007076 Ga0075435_100003503 Ga0075435_1000035034 556
158 3300007076 Ga0075435_100016884 Ga0075435_1000168844 556
159 3300007076 Ga0075435_100084994 Ga0075435_1000849942 556
160 3300009147 Ga0114129_10071714 Ga0114129_100717143 556
161 3300009174 Ga0105241_10014858 Ga0105241_100148583 556
162 3300009176 Ga0105242_10017119 Ga0105242_100171192 556
163 3300013306 Ga0163162_10007035 Ga0163162_100070355 556
164 3300025915 Ga0207693_10106335 Ga0207693_101063352 556
165 3300025922 Ga0207646_10014046 Ga0207646_100140463 556
166 3300026116 Ga0207674_10039827 Ga0207674_100398273 556
167 3300045051 Ga0451576_0025602 Ga0451576_0025602_4573_6291 556
168 3300050507 nmdc:mga05p37_52366_c1 nmdc:mga05p37_52366_c1_1651_3330 556
169 3300050510 nmdc:mga06r32_270_c1 nmdc:mga06r32_270_c1_41189_42913 556
170 3300050512 nmdc:mga0n895_124393_c1 nmdc:mga0n895_124393_c1_687_2357 556
171 3300050512 nmdc:mga0n895_168292_c1 nmdc:mga0n895_168292_c1_528_2210 556
172 3300050512 nmdc:mga0n895_46490_c1 nmdc:mga0n895_46490_c1_645_2324 556
173 3300050513 nmdc:mga0rr50_42671_c1 nmdc:mga0rr50_42671_c1_191_1900 556
174 3300050513 nmdc:mga0rr50_51638_c1 nmdc:mga0rr50_51638_c1_1031_2713 556
175 3300050515 nmdc:mga0a205_109297_c1 nmdc:mga0a205_109297_c1_319_1998 556
176 3300050515 nmdc:mga0a205_647_c1 nmdc:mga0a205_647_c1_12095_13813 556
177 3300050515 nmdc:mga0a205_82102_c1 nmdc:mga0a205_82102_c1_1223_2902 556

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

271

351

0.87

PF00211

Guanylate_cyc

Adenylate and Guanylate cyclase catalytic domain

376

559

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bw7-assembly1.cif.gz_B a novel mechanism for adenylyl cyclase inhibition from the crystal structure of its complex with catechol estrogen 0.8764 360 546
1wc5-assembly1.cif.gz_A soluble adenylyl cyclase cyac from s. platensis in complex with alpha, beta-methylene-atp in presence of bicarbonate 0.8696 360 546
1wc5-assembly1.cif.gz_D soluble adenylyl cyclase cyac from s. platensis in complex with alpha, beta-methylene-atp in presence of bicarbonate 0.8682 361 547
1wc6-assembly2.cif.gz_B-2 soluble adenylyl cyclase cyac from s. platensis in complex with rp- atpalphas in presence of bicarbonate 0.8682 360 547
1wc1-assembly2.cif.gz_B soluble adenylyl cyclase cyac from s. platensis in complex with rp- atpalphas 0.8632 361 546
ID Description Score Start End Superfamily
1wc5A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.8696 360 546 3.30.70.1230
2w01C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.864 361 555 3.30.70.1230
af_Q55F68_1579_1775_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.8609 364 545 3.30.70.1230
1wc5A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.8401 360 546 3.30.70.1230
af_P9WQ33_348_539_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.8318 361 542 3.30.70.1230
ID Description Score Start End GO Terms
AF-A0A2D4TIS3-F1-model_v4 Guanylate cyclase domain-containing protein 0.9492 389 551 GO:0004016
GO:0009190
GO:0035556
AF-A0A382RKH6-F1-model_v4 Uncharacterized protein 0.9483 6 219 GO:0016020
AF-A0A2V5MYE4-F1-model_v4 Guanylate cyclase domain-containing protein 0.9442 422 545 GO:0004016
GO:0006171
GO:0035556
AF-A0A2D6FZ35-F1-model_v4 Adenylate/guanylate cyclase domain-containing protein 0.9376 6 241 GO:0016020
AF-A0A2V6U6K4-F1-model_v4 Adenylate/guanylate cyclase domain-containing protein 0.9256 22 213 GO:0016020

Feature Viewer

pLDDT pTM Quality
85.49 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map