F269081

General Info

Members Datasets Scaffolds Average Seq Length
176 141 352 107

Family's Representative Sequence

Representative Sequence 3300049743|Ga0501081_0257855|Ga0501081_0257855_680_1018
Length 112
Sequence MSVRRGPRPLATALGEARREAQPITLLAGVQGAWASVAGARVAVEAEPVAERDGVVTIACRSATWAQELDLLSPELLSRLNAALVASGRGVPNVSVKRLRFTADRPPPTPAS

Samples

Sample ID Description Type Environment
1 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
79 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
82 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
83 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
84 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
93 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
94 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
98 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
99 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
100 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
101 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
102 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
103 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
104 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
105 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
106 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
107 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
108 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
109 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
110 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
113 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
114 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
115 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
116 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
117 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
118 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
119 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
120 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
121 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
122 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
123 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
124 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
125 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
130 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
131 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
132 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
133 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
134 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
135 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
136 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
137 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
138 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
141 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.84
Nodule 0
Rhizoplane 13.64
Rhizosphere 81.25
Stem 0
Stem Tuber 0
Unclassified 17.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501081_0257855 3300049743 Bacteria 1274
2 JGI25407J50210_10007429 3300003373 Bacteria 2744
3 Ga0070658_10627734 3300005327 Bacteria 932
4 Ga0068869_100600888 3300005334 Unclassified 929
5 Ga0070680_100157842 3300005336 Bacteria 1906
6 Ga0070660_100117817 3300005339 Bacteria 2118
7 Ga0070689_100902849 3300005340 Bacteria 782
8 Ga0070687_100247782 3300005343 Bacteria 1105
9 Ga0070692_10106901 3300005345 Unclassified 1542
10 Ga0070692_10229610 3300005345 Bacteria 1101
11 Ga0070671_100134620 3300005355 Bacteria 2083
12 Ga0070674_100179756 3300005356 Bacteria 1619
13 Ga0070709_10584611 3300005434 Bacteria 858
14 Ga0070701_10091465 3300005438 Bacteria 1667
15 Ga0070700_100298481 3300005441 Unclassified 1175
16 Ga0070694_101263661 3300005444 Bacteria 620
17 Ga0070663_100761662 3300005455 Bacteria 827
18 Ga0070678_100012756 3300005456 Bacteria 5240
19 Ga0070685_10158416 3300005466 Bacteria 1441
20 Ga0070706_101517001 3300005467 Unclassified 612
21 Ga0070698_101555406 3300005471 Bacteria 613
22 Ga0070679_100222997 3300005530 Bacteria 1846
23 Ga0070684_101516782 3300005535 Unclassified 632
24 Ga0070686_100003263 3300005544 Bacteria 8876
25 Ga0070695_100493781 3300005545 Bacteria 945
26 Ga0070665_101674014 3300005548 Bacteria 644
27 Ga0070704_100006127 3300005549 Bacteria 7062
28 Ga0070704_100154300 3300005549 Bacteria 1809
29 Ga0070704_101258192 3300005549 Bacteria 676
30 Ga0068866_11202451 3300005718 Bacteria 547
31 Ga0068861_100197557 3300005719 Bacteria 1686
32 Ga0068861_100850631 3300005719 Bacteria 860
33 Ga0068862_100089499 3300005844 Bacteria 2679
34 Ga0081455_10161152 3300005937 Bacteria 1719
35 Ga0081538_10000199 3300005981 Bacteria 66370
36 Ga0081538_10012630 3300005981 Bacteria 6758
37 Ga0081539_10029835 3300005985 Bacteria 3398
38 Ga0075365_10109401 3300006038 Bacteria 1898
39 Ga0075364_10326986 3300006051 Bacteria 1044
40 Ga0075364_10335533 3300006051 Bacteria 1030
41 Ga0070716_101196415 3300006173 Unclassified 610
42 Ga0070712_100001585 3300006175 Bacteria 13897
43 Ga0075367_10425636 3300006178 Bacteria 841
44 Ga0075428_100951053 3300006844 Bacteria 910
45 Ga0075430_100006361 3300006846 Bacteria 9958
46 Ga0075433_10048937 3300006852 Bacteria 3677
47 Ga0075433_10817214 3300006852 Bacteria 814
48 Ga0075434_100460726 3300006871 Bacteria 1292
49 Ga0075436_100375942 3300006914 Bacteria 1027
50 Ga0075435_100133457 3300007076 Bacteria 2078
51 Ga0075435_100182236 3300007076 Bacteria 1775
52 Ga0105245_10000476 3300009098 Bacteria 36689
53 Ga0105245_11287733 3300009098 Bacteria 780
54 Ga0114129_10050503 3300009147 Bacteria 5841
55 Ga0114129_10479065 3300009147 Bacteria 1628
56 Ga0114129_11996216 3300009147 Bacteria 702
57 Ga0114129_12653305 3300009147 Unclassified 597
58 Ga0114129_12986067 3300009147 Unclassified 557
59 Ga0105243_12393246 3300009148 Unclassified 566
60 Ga0105242_10947520 3300009176 Bacteria 865
61 Ga0105249_10213778 3300009553 Bacteria 1894
62 Ga0105239_10421573 3300010375 Unclassified 1512
63 Ga0105239_10625223 3300010375 Bacteria 1229
64 Ga0105246_10116935 3300011119 Unclassified 1969
65 Ga0157374_10079870 3300013296 Bacteria 3100
66 Ga0157378_10120358 3300013297 Bacteria 2419
67 Ga0157372_10692705 3300013307 Bacteria 1186
68 Ga0157375_10165831 3300013308 Unclassified 2354
69 Ga0157375_11578428 3300013308 Bacteria 776
70 Ga0157379_10048704 3300014968 Bacteria 3783
71 Ga0157376_10620605 3300014969 Bacteria 1078
72 Ga0207680_11160664 3300025903 Unclassified 551
73 Ga0207685_10060121 3300025905 Bacteria 1501
74 Ga0207705_10331125 3300025909 Bacteria 1171
75 Ga0207684_10510771 3300025910 Unclassified 1030
76 Ga0207654_11293796 3300025911 Unclassified 532
77 Ga0207693_10006563 3300025915 Bacteria 9626
78 Ga0207660_10151537 3300025917 Bacteria 1782
79 Ga0207662_10763112 3300025918 Unclassified 680
80 Ga0207657_10057998 3300025919 Bacteria 3334
81 Ga0207652_10189087 3300025921 Bacteria 1852
82 Ga0207687_10247375 3300025927 Unclassified 1416
83 Ga0207686_10736257 3300025934 Unclassified 786
84 Ga0207669_10011221 3300025937 Unclassified 4352
85 Ga0207665_10529965 3300025939 Bacteria 913
86 Ga0207711_10178702 3300025941 Bacteria 1929
87 Ga0207677_10032188 3300026023 Bacteria 3368
88 Ga0207703_10443514 3300026035 Unclassified 1211
89 Ga0207675_100359040 3300026118 Bacteria 1429
90 Ga0207683_10022207 3300026121 Bacteria 5445
91 Ga0268266_11281212 3300028379 Bacteria 708
92 Ga0268264_10247245 3300028381 Bacteria 1655
93 Ga0307405_11563621 3300031731 Bacteria 581
94 Ga0307410_10432727 3300031852 Bacteria 1070
95 Ga0307416_100455954 3300032002 Bacteria 1332
96 Ga0307416_100849312 3300032002 Unclassified 1011
97 Ga0373938_0192394 3300034957 Unclassified 562
98 Ga0373943_0296411 3300035170 Bacteria 917
99 Ga0373946_0337924 3300035171 Unclassified 751
100 Ga0373935_0455023 3300035692 Bacteria 925
101 Ga0373925_0302306 3300037068 Bacteria 1292
102 Ga0395900_0566783 3300037418 Bacteria 1079
103 Ga0395900_0810062 3300037418 Bacteria 864
104 Ga0395898_0150491 3300037466 Bacteria 2227
105 Ga0395898_0419869 3300037466 Bacteria 1275
106 Ga0395905_0311075 3300037471 Bacteria 1464
107 Ga0395905_0795025 3300037471 Bacteria 849
108 Ga0395905_1370392 3300037471 Unclassified 611
109 Ga0436364_0655137 3300037853 Bacteria 12363
110 Ga0395901_0382029 3300038443 Bacteria 1449
111 Ga0436365_0808944 3300039437 Bacteria 733
112 Ga0451802_0804311 3300041460 Bacteria 844
113 Ga0451853_0309527 3300041512 Bacteria 581
114 Ga0466960_0001113 3300044901 Bacteria 9661
115 Ga0466959_0098200 3300045049 Bacteria 2098
116 Ga0466967_0607990 3300045976 Bacteria 1079
117 Ga0466967_1986043 3300045976 Bacteria 578
118 Ga0495603_0404864 3300046455 Unclassified 782
119 Ga0495641_0052280 3300046461 Bacteria 1863
120 Ga0495650_0000049 3300046471 Bacteria 325092
121 Ga0495605_0248189 3300046474 Bacteria 762
122 Ga0495594_0190599 3300046499 Bacteria 1168
123 Ga0495656_0287662 3300046615 Bacteria 839
124 Ga0495659_0568367 3300046664 Bacteria 501
125 Ga0495588_0155515 3300046674 Bacteria 1209
126 Ga0495658_0934710 3300046683 Unclassified 554
127 Ga0495624_0606436 3300046690 Bacteria 652
128 Ga0495581_0272789 3300047315 Bacteria 989
129 Ga0495676_0017493 3300047321 Bacteria 6337
130 Ga0496100_0133786 3300048903 Bacteria 1749
131 Ga0496101_0003198 3300048904 Bacteria 10152
132 Ga0496101_1629963 3300048904 Bacteria 501
133 Ga0496102_0031129 3300048905 Bacteria 4783
134 Ga0496102_0188618 3300048905 Unclassified 1943
135 Ga0496103_0036342 3300048906 Bacteria 3016
136 Ga0496104_0300780 3300048907 Bacteria 1516
137 Ga0496105_0047179 3300048908 Bacteria 3554
138 Ga0496105_1193084 3300048908 Bacteria 561
139 Ga0496106_0291435 3300048909 Unclassified 1308
140 Ga0496107_0033718 3300048910 Bacteria 3664
141 Ga0496107_0352126 3300048910 Bacteria 1096
142 Ga0496109_0140215 3300048912 Unclassified 2260
143 Ga0496110_0059694 3300048913 Bacteria 3362
144 Ga0496111_0007367 3300048914 Bacteria 7204
145 Ga0496111_0361028 3300048914 Bacteria 1075
146 Ga0496112_0040699 3300048915 Bacteria 4544
147 Ga0496112_0059481 3300048915 Bacteria 3765
148 Ga0496113_0177187 3300048916 Bacteria 1689
149 Ga0496113_0380661 3300048916 Bacteria 1133
150 Ga0496113_0522022 3300048916 Bacteria 953
151 Ga0496114_0014316 3300048917 Bacteria 6364
152 Ga0496115_0002836 3300048918 Bacteria 12468
153 Ga0496119_0465952 3300048922 Bacteria 593
154 Ga0501034_0180097 3300049571 Bacteria 2078
155 Ga0501040_0488627 3300049576 Bacteria 887
156 Ga0501041_0973504 3300049577 Bacteria 546
157 Ga0501042_0619700 3300049578 Bacteria 787
158 Ga0501042_0674828 3300049578 Bacteria 751
159 Ga0501068_0058836 3300049584 Bacteria 2333
160 Ga0501068_0535858 3300049584 Unclassified 761
161 Ga0501068_1191333 3300049584 Bacteria 505
162 Ga0501069_1031633 3300049585 Bacteria 503
163 Ga0501072_0407600 3300049588 Bacteria 1078
164 Ga0501074_0913558 3300049590 Bacteria 618
165 Ga0501075_0114169 3300049591 Bacteria 2054
166 Ga0501075_1459046 3300049591 Unclassified 518
167 Ga0501076_1056103 3300049592 Bacteria 669
168 Ga0501077_0106751 3300049593 Bacteria 1774
169 Ga0501045_0239535 3300049824 Bacteria 1351
170 nmdc:mga00v17_362501_c1 3300050491 Bacteria 942
171 nmdc:mga0qj67_5396_c1 3300050509 Bacteria 9332
172 nmdc:mga0qj67_996521_c1 3300050509 Bacteria 657
173 nmdc:mga08y16_251539_c1 3300050511 Bacteria 1826
174 Ga0501084_0085447 3300054114 Bacteria 2649
175 Ga0501084_0201357 3300054114 Bacteria 1680
176 Ga0530510_0004410 3300061734 Bacteria 9746
177 Ga0501081_0257855
178 JGI25407J50210_10007429
179 Ga0070658_10627734
180 Ga0068869_100600888
181 Ga0070680_100157842
182 Ga0070660_100117817
183 Ga0070689_100902849
184 Ga0070687_100247782
185 Ga0070692_10106901
186 Ga0070692_10229610
187 Ga0070671_100134620
188 Ga0070674_100179756
189 Ga0070709_10584611
190 Ga0070701_10091465
191 Ga0070700_100298481
192 Ga0070694_101263661
193 Ga0070663_100761662
194 Ga0070678_100012756
195 Ga0070685_10158416
196 Ga0070706_101517001
197 Ga0070698_101555406
198 Ga0070679_100222997
199 Ga0070684_101516782
200 Ga0070686_100003263
201 Ga0070695_100493781
202 Ga0070665_101674014
203 Ga0070704_100006127
204 Ga0070704_100154300
205 Ga0070704_101258192
206 Ga0068866_11202451
207 Ga0068861_100197557
208 Ga0068861_100850631
209 Ga0068862_100089499
210 Ga0081455_10161152
211 Ga0081538_10000199
212 Ga0081538_10012630
213 Ga0081539_10029835
214 Ga0075365_10109401
215 Ga0075364_10326986
216 Ga0075364_10335533
217 Ga0070716_101196415
218 Ga0070712_100001585
219 Ga0075367_10425636
220 Ga0075428_100951053
221 Ga0075430_100006361
222 Ga0075433_10048937
223 Ga0075433_10817214
224 Ga0075434_100460726
225 Ga0075436_100375942
226 Ga0075435_100133457
227 Ga0075435_100182236
228 Ga0105245_10000476
229 Ga0105245_11287733
230 Ga0114129_10050503
231 Ga0114129_10479065
232 Ga0114129_11996216
233 Ga0114129_12653305
234 Ga0114129_12986067
235 Ga0105243_12393246
236 Ga0105242_10947520
237 Ga0105249_10213778
238 Ga0105239_10421573
239 Ga0105239_10625223
240 Ga0105246_10116935
241 Ga0157374_10079870
242 Ga0157378_10120358
243 Ga0157372_10692705
244 Ga0157375_10165831
245 Ga0157375_11578428
246 Ga0157379_10048704
247 Ga0157376_10620605
248 Ga0207680_11160664
249 Ga0207685_10060121
250 Ga0207705_10331125
251 Ga0207684_10510771
252 Ga0207654_11293796
253 Ga0207693_10006563
254 Ga0207660_10151537
255 Ga0207662_10763112
256 Ga0207657_10057998
257 Ga0207652_10189087
258 Ga0207687_10247375
259 Ga0207686_10736257
260 Ga0207669_10011221
261 Ga0207665_10529965
262 Ga0207711_10178702
263 Ga0207677_10032188
264 Ga0207703_10443514
265 Ga0207675_100359040
266 Ga0207683_10022207
267 Ga0268266_11281212
268 Ga0268264_10247245
269 Ga0307405_11563621
270 Ga0307410_10432727
271 Ga0307416_100455954
272 Ga0307416_100849312
273 Ga0373938_0192394
274 Ga0373943_0296411
275 Ga0373946_0337924
276 Ga0373935_0455023
277 Ga0373925_0302306
278 Ga0395900_0566783
279 Ga0395900_0810062
280 Ga0395898_0150491
281 Ga0395898_0419869
282 Ga0395905_0311075
283 Ga0395905_0795025
284 Ga0395905_1370392
285 Ga0436364_0655137
286 Ga0395901_0382029
287 Ga0436365_0808944
288 Ga0451802_0804311
289 Ga0451853_0309527
290 Ga0466960_0001113
291 Ga0466959_0098200
292 Ga0466967_0607990
293 Ga0466967_1986043
294 Ga0495603_0404864
295 Ga0495641_0052280
296 Ga0495650_0000049
297 Ga0495605_0248189
298 Ga0495594_0190599
299 Ga0495656_0287662
300 Ga0495659_0568367
301 Ga0495588_0155515
302 Ga0495658_0934710
303 Ga0495624_0606436
304 Ga0495581_0272789
305 Ga0495676_0017493
306 Ga0496100_0133786
307 Ga0496101_0003198
308 Ga0496101_1629963
309 Ga0496102_0031129
310 Ga0496102_0188618
311 Ga0496103_0036342
312 Ga0496104_0300780
313 Ga0496105_0047179
314 Ga0496105_1193084
315 Ga0496106_0291435
316 Ga0496107_0033718
317 Ga0496107_0352126
318 Ga0496109_0140215
319 Ga0496110_0059694
320 Ga0496111_0007367
321 Ga0496111_0361028
322 Ga0496112_0040699
323 Ga0496112_0059481
324 Ga0496113_0177187
325 Ga0496113_0380661
326 Ga0496113_0522022
327 Ga0496114_0014316
328 Ga0496115_0002836
329 Ga0496119_0465952
330 Ga0501034_0180097
331 Ga0501040_0488627
332 Ga0501041_0973504
333 Ga0501042_0619700
334 Ga0501042_0674828
335 Ga0501068_0058836
336 Ga0501068_0535858
337 Ga0501068_1191333
338 Ga0501069_1031633
339 Ga0501072_0407600
340 Ga0501074_0913558
341 Ga0501075_0114169
342 Ga0501075_1459046
343 Ga0501076_1056103
344 Ga0501077_0106751
345 Ga0501045_0239535
346 nmdc:mga00v17_362501_c1
347 nmdc:mga0qj67_5396_c1
348 nmdc:mga0qj67_996521_c1
349 nmdc:mga08y16_251539_c1
350 Ga0501084_0085447
351 Ga0501084_0201357
352 Ga0530510_0004410

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05258

DciA

Dna[CI] antecedent, DciA

9

101

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ykm-assembly1.cif.gz_A structure of dcia duf721 domain from deinococcus radiodurans 0.9263 27 95
7ykm-assembly1.cif.gz_A structure of dcia duf721 domain from deinococcus radiodurans 0.7864 27 95
2wp0-assembly1.cif.gz_C-2 crystal structure of a hoba-dnaa (domain i-ii) complex from helicobacter pylori. 0.7249 44 95
2dyj-assembly2.cif.gz_B crystal structure of ribosome-binding factor a from thermus thermophilus hb8 0.7019 24 95
4tps-assembly1.cif.gz_B sporulation inhibitor of dna replication, sira, in complex with domain i of dnaa 0.6853 25 95
ID Description Score Start End Superfamily
af_P9WNW3_9_100_3.30.300.180 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;DnaA, N-terminal domain 0.7814 40 93 3.30.300.180
af_P9WFL1_75_162_3.30.300.180 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;DnaA, N-terminal domain 0.777 10 92 3.30.300.180
3gr0C01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7527 45 94 3.30.70.1780
af_P9WFL1_75_162_3.30.300.180 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;DnaA, N-terminal domain 0.728 10 92 3.30.300.180
2wp0C00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;DnaA, N-terminal domain 0.7249 44 95 3.30.300.180
ID Description Score Start End GO Terms
AF-A0A7V9LHU5-F1-model_v4 DUF721 domain-containing protein 0.9887 21 96
AF-A0A1Q3NJF9-F1-model_v4 deleted 0.9643 27 95
AF-A0A7W0UBJ1-F1-model_v4 DUF721 domain-containing protein 0.9596 22 97
AF-A0A833L228-F1-model_v4 DUF721 domain-containing protein 0.9381 27 95
AF-A0A7C4BTA1-F1-model_v4 DUF721 domain-containing protein 0.9375 29 95

Map