F268840

General Info

Members Datasets Scaffolds Average Seq Length
176 122 176 223

Family's Representative Sequence

Representative Sequence 3300046463|Ga0495653_0014988|Ga0495653_0014988_3585_4244
Length 212
Sequence MSERMMKIIASPRVAPSILSADFARLGAQLDEVMDAGARVIHFDVMDGHFVPPITIGPLVAAGGVIDVHLMIEQPERQIEAFAEAGADSITFHEEATPHANRTLSAIRDLGCLAGIALNPGTPVEAVSELSGLADIVLCMTVNPGWGGQSFIGGSPDKVSRLKSLVGEAKIEVDGGIDAETAGSVAAAGASLFGAVDPAAAYSKIAAAAGAA

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
8 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
9 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
10 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
12 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
13 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
14 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
15 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
16 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
17 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
18 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
19 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
20 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
22 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
24 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
25 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
28 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
29 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
30 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
31 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
32 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
33 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
45 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
46 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
47 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
48 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
49 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
50 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
51 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
52 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
53 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
54 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
55 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
56 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
57 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
58 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
59 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
60 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
61 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
62 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
63 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
64 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
65 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
66 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
67 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
68 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
69 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
70 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
71 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
72 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
73 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
74 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
75 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
76 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
77 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
78 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
79 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
80 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
81 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
82 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
83 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
84 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
85 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
86 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
87 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
88 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
89 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
90 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
97 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
98 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
99 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
100 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
101 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
102 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
103 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
104 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
105 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
106 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
108 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
109 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
110 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
111 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
112 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
113 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
114 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
115 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
116 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
117 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
118 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
119 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
120 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
121 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
122 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.55
Nodule 0
Rhizoplane 7.95
Rhizosphere 87.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10017599 3300001979 Bacteria 2551
2 JGI24034J26672_10000176 3300002239 Bacteria 8785
3 JGI25404J52841_10020731 3300003659 Bacteria 1423
4 Ga0070683_100077587 3300005329 Bacteria 3107
5 Ga0070691_10001612 3300005341 Bacteria 9770
6 Ga0070661_100154463 3300005344 Bacteria 1736
7 Ga0070678_100159677 3300005456 Bacteria 1825
8 Ga0068864_100000031 3300005618 Bacteria 215331
9 Ga0068858_100019069 3300005842 Bacteria 6417
10 Ga0081455_10090655 3300005937 Bacteria 2478
11 Ga0081538_10000103 3300005981 Bacteria 83685
12 Ga0081540_1000650 3300005983 Bacteria 32779
13 Ga0075365_10000681 3300006038 Bacteria 13645
14 Ga0075365_10000974 3300006038 Bacteria 12194
15 Ga0075364_10001605 3300006051 Bacteria 12371
16 Ga0097621_100479606 3300006237 Bacteria 1124
17 Ga0075431_100000832 3300006847 Bacteria 26974
18 Ga0075431_100876561 3300006847 Bacteria 868
19 Ga0075433_10000373 3300006852 Bacteria 28166
20 Ga0075433_10006421 3300006852 Bacteria 9298
21 Ga0075434_100005700 3300006871 Bacteria 11373
22 Ga0075434_100325536 3300006871 Unclassified 1557
23 Ga0075436_100184431 3300006914 Bacteria 1475
24 Ga0111539_10002660 3300009094 Bacteria 23683
25 Ga0105247_10143375 3300009101 Bacteria 1567
26 Ga0114129_10030557 3300009147 Bacteria 7622
27 Ga0114129_10120770 3300009147 Bacteria 3608
28 Ga0114129_10231192 3300009147 Bacteria 2490
29 Ga0105243_10961001 3300009148 Bacteria 854
30 Ga0105241_11046132 3300009174 Bacteria 766
31 Ga0105242_10035230 3300009176 Bacteria 4014
32 Ga0105239_10101936 3300010375 Bacteria 3176
33 Ga0157378_10614129 3300013297 Bacteria 1100
34 Ga0163162_11014515 3300013306 Bacteria 938
35 Ga0157375_10000236 3300013308 Bacteria 51196
36 Ga0157380_10000614 3300014326 Bacteria 21967
37 Ga0157379_10481129 3300014968 Bacteria 1149
38 Ga0163161_10158504 3300017792 Bacteria 1725
39 Ga0207657_10230895 3300025919 Bacteria 1480
40 Ga0207687_10702382 3300025927 Bacteria 858
41 Ga0207709_10450691 3300025935 Bacteria 994
42 Ga0207661_10037837 3300025944 Bacteria 3777
43 Ga0207667_10049205 3300025949 Bacteria 4453
44 Ga0207668_10596938 3300025972 Bacteria 961
45 Ga0207677_10761368 3300026023 Bacteria 864
46 Ga0207703_10000257 3300026035 Bacteria 59688
47 Ga0207648_10431599 3300026089 Bacteria 1197
48 Ga0207676_10000031 3300026095 Bacteria 215877
49 Ga0207683_10013808 3300026121 Bacteria 6887
50 Ga0207428_10024818 3300027907 Bacteria 5029
51 Ga0316576_10005935 3300031727 Bacteria 7539
52 Ga0316577_10051176 3300031733 Bacteria 2305
53 Ga0316574_0006071 3300035398 Bacteria 6496
54 Ga0373937_0298907 3300036401 Bacteria 1521
55 Ga0316584_0000598 3300036712 Bacteria 19526
56 Ga0395898_0097346 3300037466 Bacteria 2826
57 Ga0395901_0236085 3300038443 Bacteria 1908
58 Ga0466964_0093620 3300044706 Bacteria 1312
59 Ga0466967_0032117 3300045976 Bacteria 4429
60 Ga0466967_0201174 3300045976 Bacteria 1887
61 Ga0495592_0171744 3300046454 Bacteria 1484
62 Ga0495603_0000745 3300046455 Bacteria 18633
63 Ga0495629_0082203 3300046459 Bacteria 2248
64 Ga0495638_0047811 3300046460 Unclassified 2681
65 Ga0495651_0139767 3300046462 Bacteria 1758
66 Ga0495653_0014988 3300046463 Bacteria 6322
67 Ga0495662_0000102 3300046476 Bacteria 31112
68 Ga0495662_0054135 3300046476 Bacteria 1938
69 Ga0495608_0040177 3300046511 Bacteria 3134
70 Ga0495618_0037042 3300046514 Bacteria 3062
71 Ga0495628_0056245 3300046516 Bacteria 3098
72 Ga0495628_0093814 3300046516 Bacteria 2321
73 Ga0495628_0628104 3300046516 Bacteria 765
74 Ga0495630_0002067 3300046517 Bacteria 13956
75 Ga0495630_0003334 3300046517 Bacteria 11188
76 Ga0495630_0061867 3300046517 Bacteria 2812
77 Ga0495640_0021270 3300046533 Bacteria 4763
78 Ga0495586_0000426 3300046535 Bacteria 25579
79 Ga0495621_0000928 3300046539 Bacteria 7451
80 Ga0495667_0012002 3300046559 Bacteria 5869
81 Ga0495667_0134850 3300046559 Bacteria 1592
82 Ga0495656_0005210 3300046615 Bacteria 4481
83 Ga0495634_0000034 3300046642 Bacteria 106338
84 Ga0495634_0014432 3300046642 Bacteria 5695
85 Ga0495635_0019611 3300046663 Bacteria 4711
86 Ga0495647_0001914 3300046681 Bacteria 6483
87 Ga0495613_0000083 3300046689 Bacteria 90138
88 Ga0495613_0017013 3300046689 Bacteria 5413
89 Ga0495600_0008671 3300046809 Bacteria 6257
90 Ga0495600_0112749 3300046809 Bacteria 1770
91 Ga0495676_0005546 3300047321 Bacteria 11576
92 Ga0495680_0016482 3300047322 Bacteria 6345
93 Ga0495684_0056555 3300047471 Bacteria 2991
94 Ga0495593_0160651 3300047673 Bacteria 1134
95 Ga0495593_0177345 3300047673 Bacteria 1073
96 Ga0495602_0138461 3300048088 Bacteria 1930
97 Ga0496100_0000005 3300048903 Bacteria 312112
98 Ga0496101_0000022 3300048904 Bacteria 216728
99 Ga0496105_0075230 3300048908 Bacteria 2789
100 Ga0496106_0000108 3300048909 Bacteria 64484
101 Ga0496106_0097277 3300048909 Bacteria 2279
102 Ga0496107_0000011 3300048910 Bacteria 201631
103 Ga0496108_0001524 3300048911 Bacteria 18334
104 Ga0496108_0035619 3300048911 Bacteria 4138
105 Ga0496109_0000172 3300048912 Bacteria 64023
106 Ga0496109_0033694 3300048912 Bacteria 4609
107 Ga0496109_0235375 3300048912 Bacteria 1723
108 Ga0496112_0000013 3300048915 Bacteria 237194
109 Ga0496113_0016486 3300048916 Bacteria 5105
110 Ga0496115_0718826 3300048918 Bacteria 784
111 Ga0501031_0156170 3300049568 Bacteria 1491
112 Ga0501036_0029980 3300049572 Bacteria 4597
113 Ga0501036_0073253 3300049572 Bacteria 2896
114 Ga0501038_0211784 3300049574 Bacteria 1550
115 Ga0501039_0025314 3300049575 Bacteria 4559
116 Ga0501040_0070496 3300049576 Bacteria 2412
117 Ga0501042_0127177 3300049578 Bacteria 1835
118 Ga0501042_0152552 3300049578 Bacteria 1666
119 Ga0501042_0200197 3300049578 Bacteria 1440
120 Ga0501068_0140479 3300049584 Bacteria 1514
121 Ga0501069_0138425 3300049585 Bacteria 1396
122 Ga0501069_0375874 3300049585 Bacteria 839
123 Ga0501071_0179415 3300049587 Bacteria 1587
124 Ga0501072_0015204 3300049588 Bacteria 5900
125 Ga0501074_0080131 3300049590 Bacteria 2343
126 Ga0501075_0064870 3300049591 Bacteria 2755
127 Ga0501076_0007042 3300049592 Bacteria 8168
128 Ga0501076_0083080 3300049592 Bacteria 2572
129 Ga0501076_0668660 3300049592 Bacteria 857
130 Ga0501077_0063347 3300049593 Bacteria 2346
131 Ga0501077_0229198 3300049593 Bacteria 1181
132 Ga0501077_0364212 3300049593 Bacteria 923
133 Ga0501079_0007202 3300049741 Bacteria 8398
134 Ga0501079_0047882 3300049741 Bacteria 3299
135 Ga0501079_0283203 3300049741 Bacteria 1296
136 Ga0501081_0062085 3300049743 Bacteria 2591
137 Ga0501081_0081100 3300049743 Bacteria 2272
138 Ga0501081_0100184 3300049743 Bacteria 2048
139 Ga0501081_0361489 3300049743 Bacteria 1071
140 Ga0501081_0765070 3300049743 Bacteria 726
141 Ga0501035_0509518 3300049822 Bacteria 990
142 Ga0501045_0009157 3300049824 Bacteria 6918
143 Ga0501045_0072517 3300049824 Bacteria 2535
144 nmdc:mga00v17_12735_c1 3300050491 Bacteria 4646
145 nmdc:mga00v17_9438_c1 3300050491 Bacteria 5280
146 nmdc:mga0yw44_15550_c1 3300050492 Bacteria 4080
147 nmdc:mga0yw44_22377_c1 3300050492 Bacteria 3544
148 nmdc:mga0yw44_53621_c1 3300050492 Bacteria 2449
149 nmdc:mga05p37_21224_c1 3300050507 Bacteria 7861
150 nmdc:mga09592_190428_c1 3300050508 Bacteria 1775
151 nmdc:mga06r32_1573_c1 3300050510 Bacteria 20560
152 nmdc:mga06r32_99515_c1 3300050510 Bacteria 2852
153 nmdc:mga08y16_6839_c1 3300050511 Bacteria 11957
154 nmdc:mga0n895_14586_c1 3300050512 Bacteria 7143
155 nmdc:mga08x19_389743_c1 3300050514 Bacteria 976
156 nmdc:mga0a205_1844_c1 3300050515 Bacteria 18344
157 nmdc:mga0a205_6_c1 3300050515 Bacteria 129758
158 Ga0495601_0001920 3300053077 Bacteria 11625
159 Ga0495601_0050838 3300053077 Bacteria 2615
160 Ga0495601_0092668 3300053077 Bacteria 1946
161 Ga0495612_0000022 3300053078 Bacteria 119126
162 Ga0495612_0014665 3300053078 Bacteria 3149
163 Ga0495619_0000037 3300053085 Bacteria 124007
164 Ga0495619_0000077 3300053085 Bacteria 73017
165 Ga0495619_0000373 3300053085 Bacteria 30829
166 Ga0495619_0003899 3300053085 Bacteria 9590
167 Ga0495619_0004151 3300053085 Bacteria 9257
168 Ga0495619_0047738 3300053085 Bacteria 2821
169 Ga0495619_0056725 3300053085 Bacteria 2597
170 Ga0501084_0005497 3300054114 Bacteria 10403
171 Ga0501084_0074327 3300054114 Bacteria 2846
172 Ga0501082_0052476 3300060353 Bacteria 3515
173 Ga0501082_0098069 3300060353 Bacteria 2534
174 Ga0501082_0150404 3300060353 Bacteria 2022
175 Ga0530510_0080106 3300061734 Bacteria 2376
176 Ga0530510_0102545 3300061734 Bacteria 2092

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046517 Ga0495630_0002067 Ga0495630_0002067_8411_9097 185
2 3300005456 Ga0070678_100159677 Ga0070678_1001596772 192
3 3300026121 Ga0207683_10013808 Ga0207683_100138081 193
4 3300013308 Ga0157375_10000236 Ga0157375_1000023641 197
5 3300025949 Ga0207667_10049205 Ga0207667_100492052 199
6 3300025972 Ga0207668_10596938 Ga0207668_105969381 199
7 3300047322 Ga0495680_0016482 Ga0495680_0016482_3172_3858 199
8 3300025927 Ga0207687_10702382 Ga0207687_107023821 200
9 3300049743 Ga0501081_0100184 Ga0501081_0100184_97_783 200
10 3300006852 Ga0075433_10006421 Ga0075433_1000642111 201
11 3300048911 Ga0496108_0035619 Ga0496108_0035619_1010_1696 201
12 3300048912 Ga0496109_0033694 Ga0496109_0033694_984_1670 201
13 3300050515 nmdc:mga0a205_1844_c1 nmdc:mga0a205_1844_c1_10169_10855 201
14 3300046476 Ga0495662_0054135 Ga0495662_0054135_421_1107 202
15 3300047673 Ga0495593_0177345 Ga0495593_0177345_75_761 202
16 3300046689 Ga0495613_0000083 Ga0495613_0000083_6567_7253 203
17 3300005329 Ga0070683_100077587 Ga0070683_1000775873 204
18 3300005344 Ga0070661_100154463 Ga0070661_1001544632 204
19 3300025944 Ga0207661_10037837 Ga0207661_100378372 204
20 3300046459 Ga0495629_0082203 Ga0495629_0082203_1156_1830 204
21 3300046535 Ga0495586_0000426 Ga0495586_0000426_13130_13816 204
22 3300046460 Ga0495638_0047811 Ga0495638_0047811_394_1068 206
23 3300049587 Ga0501071_0179415 Ga0501071_0179415_38_721 206
24 3300049822 Ga0501035_0509518 Ga0501035_0509518_237_923 206
25 3300005618 Ga0068864_100000031 Ga0068864_100000031144 207
26 3300026095 Ga0207676_10000031 Ga0207676_10000031143 207
27 3300046539 Ga0495621_0000928 Ga0495621_0000928_2397_3083 207
28 3300046559 Ga0495667_0012002 Ga0495667_0012002_3966_4652 207
29 3300046809 Ga0495600_0008671 Ga0495600_0008671_4855_5541 207
30 3300046463 Ga0495653_0014988 Ga0495653_0014988_3585_4244 208
31 3300046689 Ga0495613_0017013 Ga0495613_0017013_4458_5132 208
32 3300049743 Ga0501081_0361489 Ga0501081_0361489_194_880 209
33 3300036401 Ga0373937_0298907 Ga0373937_0298907_818_1504 212
34 3300046516 Ga0495628_0628104 Ga0495628_0628104_26_712 212
35 3300046663 Ga0495635_0019611 Ga0495635_0019611_215_901 212
36 3300053085 Ga0495619_0000077 Ga0495619_0000077_23769_24455 212
37 3300046476 Ga0495662_0000102 Ga0495662_0000102_14868_15554 214
38 3300053085 Ga0495619_0000037 Ga0495619_0000037_122387_123073 214
39 3300045976 Ga0466967_0032117 Ga0466967_0032117_344_1030 215
40 3300049572 Ga0501036_0029980 Ga0501036_0029980_1454_2101 215
41 3300049574 Ga0501038_0211784 Ga0501038_0211784_295_942 215
42 3300049576 Ga0501040_0070496 Ga0501040_0070496_1560_2207 215
43 3300049585 Ga0501069_0138425 Ga0501069_0138425_603_1250 215
44 3300049588 Ga0501072_0015204 Ga0501072_0015204_3867_4514 215
45 3300049590 Ga0501074_0080131 Ga0501074_0080131_826_1473 215
46 3300049591 Ga0501075_0064870 Ga0501075_0064870_1702_2349 215
47 3300049592 Ga0501076_0007042 Ga0501076_0007042_1229_1876 215
48 3300049593 Ga0501077_0063347 Ga0501077_0063347_666_1313 215
49 3300049741 Ga0501079_0007202 Ga0501079_0007202_612_1259 215
50 3300049743 Ga0501081_0081100 Ga0501081_0081100_726_1373 215
51 3300049824 Ga0501045_0072517 Ga0501045_0072517_788_1435 215
52 3300054114 Ga0501084_0005497 Ga0501084_0005497_2348_2995 215
53 3300060353 Ga0501082_0098069 Ga0501082_0098069_345_992 215
54 3300061734 Ga0530510_0102545 Ga0530510_0102545_1425_2072 215
55 3300009176 Ga0105242_10035230 Ga0105242_100352304 217
56 3300025919 Ga0207657_10230895 Ga0207657_102308952 217
57 3300046455 Ga0495603_0000745 Ga0495603_0000745_11835_12509 217
58 3300026023 Ga0207677_10761368 Ga0207677_107613682 218
59 3300046642 Ga0495634_0000034 Ga0495634_0000034_44269_44943 219
60 3300048911 Ga0496108_0001524 Ga0496108_0001524_8280_8987 222
61 3300048912 Ga0496109_0000172 Ga0496109_0000172_15942_16649 222
62 3300006237 Ga0097621_100479606 Ga0097621_1004796061 223
63 3300006847 Ga0075431_100000832 Ga0075431_1000008325 223
64 3300006871 Ga0075434_100005700 Ga0075434_1000057006 223
65 3300009094 Ga0111539_10002660 Ga0111539_100026603 223
66 3300009147 Ga0114129_10030557 Ga0114129_100305576 223
67 3300013306 Ga0163162_11014515 Ga0163162_110145152 223
68 3300017792 Ga0163161_10158504 Ga0163161_101585043 223
69 3300027907 Ga0207428_10024818 Ga0207428_100248183 223
70 3300050507 nmdc:mga05p37_21224_c1 nmdc:mga05p37_21224_c1_1941_2618 223
71 3300050508 nmdc:mga09592_190428_c1 nmdc:mga09592_190428_c1_30_707 223
72 3300050510 nmdc:mga06r32_1573_c1 nmdc:mga06r32_1573_c1_8333_9010 223
73 3300050511 nmdc:mga08y16_6839_c1 nmdc:mga08y16_6839_c1_10837_11514 223
74 3300050512 nmdc:mga0n895_14586_c1 nmdc:mga0n895_14586_c1_337_1014 223
75 3300001979 JGI24740J21852_10017599 JGI24740J21852_100175992 224
76 3300002239 JGI24034J26672_10000176 JGI24034J26672_100001767 224
77 3300003659 JGI25404J52841_10020731 JGI25404J52841_100207311 224
78 3300005341 Ga0070691_10001612 Ga0070691_100016128 224
79 3300005842 Ga0068858_100019069 Ga0068858_1000190695 224
80 3300005937 Ga0081455_10090655 Ga0081455_100906552 224
81 3300005981 Ga0081538_10000103 Ga0081538_1000010350 224
82 3300005983 Ga0081540_1000650 Ga0081540_10006503 224
83 3300006038 Ga0075365_10000681 Ga0075365_100006819 224
84 3300006038 Ga0075365_10000974 Ga0075365_100009745 224
85 3300006051 Ga0075364_10001605 Ga0075364_100016055 224
86 3300006847 Ga0075431_100876561 Ga0075431_1008765611 224
87 3300006852 Ga0075433_10000373 Ga0075433_1000037311 224
88 3300006871 Ga0075434_100325536 Ga0075434_1003255362 224
89 3300006914 Ga0075436_100184431 Ga0075436_1001844312 224
90 3300009101 Ga0105247_10143375 Ga0105247_101433753 224
91 3300009147 Ga0114129_10120770 Ga0114129_101207702 224
92 3300009147 Ga0114129_10231192 Ga0114129_102311922 224
93 3300009148 Ga0105243_10961001 Ga0105243_109610012 224
94 3300009174 Ga0105241_11046132 Ga0105241_110461321 224
95 3300010375 Ga0105239_10101936 Ga0105239_101019364 224
96 3300013297 Ga0157378_10614129 Ga0157378_106141291 224
97 3300014326 Ga0157380_10000614 Ga0157380_100006147 224
98 3300014968 Ga0157379_10481129 Ga0157379_104811291 224
99 3300025935 Ga0207709_10450691 Ga0207709_104506912 224
100 3300026035 Ga0207703_10000257 Ga0207703_1000025755 224
101 3300026089 Ga0207648_10431599 Ga0207648_104315992 224
102 3300031727 Ga0316576_10005935 Ga0316576_100059355 224
103 3300031733 Ga0316577_10051176 Ga0316577_100511762 224
104 3300035398 Ga0316574_0006071 Ga0316574_0006071_2533_3243 224
105 3300036712 Ga0316584_0000598 Ga0316584_0000598_4920_5609 224
106 3300037466 Ga0395898_0097346 Ga0395898_0097346_101_781 224
107 3300038443 Ga0395901_0236085 Ga0395901_0236085_1140_1820 224
108 3300044706 Ga0466964_0093620 Ga0466964_0093620_458_1138 224
109 3300045976 Ga0466967_0201174 Ga0466967_0201174_409_1089 224
110 3300046454 Ga0495592_0171744 Ga0495592_0171744_607_1293 224
111 3300046462 Ga0495651_0139767 Ga0495651_0139767_839_1528 224
112 3300046511 Ga0495608_0040177 Ga0495608_0040177_2264_2938 224
113 3300046514 Ga0495618_0037042 Ga0495618_0037042_342_1028 224
114 3300046516 Ga0495628_0056245 Ga0495628_0056245_1266_1940 224
115 3300046516 Ga0495628_0093814 Ga0495628_0093814_165_839 224
116 3300046517 Ga0495630_0003334 Ga0495630_0003334_8029_8703 224
117 3300046517 Ga0495630_0061867 Ga0495630_0061867_760_1446 224
118 3300046533 Ga0495640_0021270 Ga0495640_0021270_2141_2827 224
119 3300046559 Ga0495667_0134850 Ga0495667_0134850_692_1378 224
120 3300046615 Ga0495656_0005210 Ga0495656_0005210_3490_4164 224
121 3300046642 Ga0495634_0014432 Ga0495634_0014432_2747_3436 224
122 3300046681 Ga0495647_0001914 Ga0495647_0001914_1882_2568 224
123 3300046809 Ga0495600_0112749 Ga0495600_0112749_29_715 224
124 3300047321 Ga0495676_0005546 Ga0495676_0005546_6638_7324 224
125 3300047471 Ga0495684_0056555 Ga0495684_0056555_469_1143 224
126 3300047673 Ga0495593_0160651 Ga0495593_0160651_405_1079 224
127 3300048088 Ga0495602_0138461 Ga0495602_0138461_1158_1832 224
128 3300048903 Ga0496100_0000005 Ga0496100_0000005_140059_140745 224
129 3300048904 Ga0496101_0000022 Ga0496101_0000022_100941_101627 224
130 3300048908 Ga0496105_0075230 Ga0496105_0075230_317_1009 224
131 3300048909 Ga0496106_0000108 Ga0496106_0000108_23971_24657 224
132 3300048909 Ga0496106_0097277 Ga0496106_0097277_266_979 224
133 3300048910 Ga0496107_0000011 Ga0496107_0000011_171138_171824 224
134 3300048912 Ga0496109_0235375 Ga0496109_0235375_665_1375 224
135 3300048915 Ga0496112_0000013 Ga0496112_0000013_208452_209138 224
136 3300048916 Ga0496113_0016486 Ga0496113_0016486_3585_4271 224
137 3300048918 Ga0496115_0718826 Ga0496115_0718826_18_695 224
138 3300049568 Ga0501031_0156170 Ga0501031_0156170_26_736 224
139 3300049572 Ga0501036_0073253 Ga0501036_0073253_678_1388 224
140 3300049575 Ga0501039_0025314 Ga0501039_0025314_2623_3309 224
141 3300049578 Ga0501042_0127177 Ga0501042_0127177_1021_1695 224
142 3300049578 Ga0501042_0152552 Ga0501042_0152552_88_774 224
143 3300049578 Ga0501042_0200197 Ga0501042_0200197_128_838 224
144 3300049584 Ga0501068_0140479 Ga0501068_0140479_180_854 224
145 3300049585 Ga0501069_0375874 Ga0501069_0375874_54_764 224
146 3300049592 Ga0501076_0083080 Ga0501076_0083080_887_1573 224
147 3300049592 Ga0501076_0668660 Ga0501076_0668660_45_755 224
148 3300049593 Ga0501077_0229198 Ga0501077_0229198_165_908 224
149 3300049593 Ga0501077_0364212 Ga0501077_0364212_13_723 224
150 3300049741 Ga0501079_0047882 Ga0501079_0047882_608_1318 224
151 3300049741 Ga0501079_0283203 Ga0501079_0283203_359_1036 224
152 3300049743 Ga0501081_0062085 Ga0501081_0062085_115_825 224
153 3300049743 Ga0501081_0765070 Ga0501081_0765070_10_696 224
154 3300049824 Ga0501045_0009157 Ga0501045_0009157_4195_4905 224
155 3300050491 nmdc:mga00v17_12735_c1 nmdc:mga00v17_12735_c1_1499_2179 224
156 3300050491 nmdc:mga00v17_9438_c1 nmdc:mga00v17_9438_c1_4505_5200 224
157 3300050492 nmdc:mga0yw44_15550_c1 nmdc:mga0yw44_15550_c1_365_1045 224
158 3300050492 nmdc:mga0yw44_22377_c1 nmdc:mga0yw44_22377_c1_101_781 224
159 3300050492 nmdc:mga0yw44_53621_c1 nmdc:mga0yw44_53621_c1_1611_2306 224
160 3300050510 nmdc:mga06r32_99515_c1 nmdc:mga06r32_99515_c1_262_972 224
161 3300050514 nmdc:mga08x19_389743_c1 nmdc:mga08x19_389743_c1_13_726 224
162 3300050515 nmdc:mga0a205_6_c1 nmdc:mga0a205_6_c1_17702_18388 224
163 3300053077 Ga0495601_0001920 Ga0495601_0001920_8607_9281 224
164 3300053077 Ga0495601_0050838 Ga0495601_0050838_1533_2207 224
165 3300053077 Ga0495601_0092668 Ga0495601_0092668_627_1313 224
166 3300053078 Ga0495612_0000022 Ga0495612_0000022_104501_105187 224
167 3300053078 Ga0495612_0014665 Ga0495612_0014665_582_1268 224
168 3300053085 Ga0495619_0000373 Ga0495619_0000373_28731_29417 224
169 3300053085 Ga0495619_0003899 Ga0495619_0003899_1106_1780 224
170 3300053085 Ga0495619_0004151 Ga0495619_0004151_6940_7626 224
171 3300053085 Ga0495619_0047738 Ga0495619_0047738_656_1330 224
172 3300053085 Ga0495619_0056725 Ga0495619_0056725_665_1351 224
173 3300054114 Ga0501084_0074327 Ga0501084_0074327_791_1534 224
174 3300060353 Ga0501082_0052476 Ga0501082_0052476_131_841 224
175 3300060353 Ga0501082_0150404 Ga0501082_0150404_1019_1762 224
176 3300061734 Ga0530510_0080106 Ga0530510_0080106_493_1203 224

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00834

Ribul_P_3_epim

Ribulose-phosphate 3 epimerase family

13

198

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5umf-assembly1.cif.gz_C crystal structure of a ribulose-phosphate 3-epimerase from neisseria gonorrhoeae with bound phosphate 0.9172 7 220
7b1w-assembly2.cif.gz_K-3 crystal structure of plastidial ribulose epimerase rpe1 from the model alga chlamydomonas reinhardtii 0.9159 5 217
3ovr-assembly1.cif.gz_B crystal structure of hrpe and d-xylulose 5-phosphate complex 0.9135 8 222
1rpx-assembly1.cif.gz_A d-ribulose-5-phosphate 3-epimerase from solanum tuberosum chloroplasts 0.9121 5 220
1tqj-assembly1.cif.gz_B crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution 0.908 7 217
ID Description Score Start End Superfamily
af_P39362_1_210_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9176 9 219 3.20.20.70
af_A0A0G2JW38_1_228_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9113 7 221 3.20.20.70
2fliC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9071 7 220 3.20.20.70
af_P39362_1_210_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9053 9 219 3.20.20.70
af_P9WI51_4_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9019 7 222 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A838PKF6-F1-model_v4 Ribulose-phosphate 3-epimerase 0.9618 4 117 GO:0005975
GO:0016857
AF-A0A538INV9-F1-model_v4 Ribulose-phosphate 3-epimerase 0.9499 2 146 GO:0005975
GO:0016857
AF-A0A7V9RIA9-F1-model_v4 Ribulose-phosphate 3-epimerase 0.9484 34 222 GO:0005975
GO:0016857
AF-A0A2A6RLI7-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9479 9 221 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A538JME7-F1-model_v4 Ribulose-phosphate 3-epimerase 0.9442 2 220 GO:0005975
GO:0016857

Feature Viewer

pLDDT pTM Quality
91.31 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map