F267876

General Info

Members Datasets Scaffolds Average Seq Length
176 116 352 149

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100106088|Ga0070699_1001060882
Length 164
Sequence MAEAKPTKSKQKSAKSTTASGKRYKGFTSEERAAMVDRVQEMKVAGRRGPRADQADAESEVLAKIAELPESDRAMAKQIHAVVMASAPDLSPRLWYGMPAYAKDGKIVCHFQSAQKFKTRYATIGFSDAAHLDEGNMWPNAFALTKLTAADEARIGALVKKAVR

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
65 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
66 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
67 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
68 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
69 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
70 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
71 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
72 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
73 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
74 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
75 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
76 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
77 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
78 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
79 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
80 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
81 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
82 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
83 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
84 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
85 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
86 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
87 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
88 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
89 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
90 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
91 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
92 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
93 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
94 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
95 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
96 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
97 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
98 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
99 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
100 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
101 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
102 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
104 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
105 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
106 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
107 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
108 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
109 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
110 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
111 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
112 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
113 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
114 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
115 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
116 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.73
Metatranscriptomes 0.57
Isolates 1.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.57
Nodule 0
Rhizoplane 6.25
Rhizosphere 89.77
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100106088 3300005518 Bacteria 2464
2 Ga0065707_10035626 3300005295 Bacteria 1129
3 Ga0070676_10688288 3300005328 Bacteria 746
4 Ga0068869_101324258 3300005334 Bacteria 636
5 Ga0068868_100560812 3300005338 Bacteria 1008
6 Ga0070668_100685405 3300005347 Bacteria 903
7 Ga0070673_100269141 3300005364 Bacteria 1491
8 Ga0070667_100261082 3300005367 Bacteria 1551
9 Ga0070714_100175080 3300005435 Bacteria 1949
10 Ga0070714_101060969 3300005435 Bacteria 789
11 Ga0070705_100756924 3300005440 Bacteria 768
12 Ga0070694_100324011 3300005444 Bacteria 1187
13 Ga0070708_100001132 3300005445 Bacteria 20455
14 Ga0070708_100037160 3300005445 Bacteria 4247
15 Ga0070708_100089701 3300005445 Bacteria 2797
16 Ga0070708_100602819 3300005445 Bacteria 1035
17 Ga0070706_100000319 3300005467 Bacteria 58620
18 Ga0070706_100018847 3300005467 Bacteria 6364
19 Ga0070706_100212975 3300005467 Bacteria 1804
20 Ga0070707_100007804 3300005468 Bacteria 9939
21 Ga0070707_100014962 3300005468 Bacteria 7280
22 Ga0070707_100024357 3300005468 Bacteria 5731
23 Ga0070707_100230827 3300005468 Bacteria 1801
24 Ga0070707_100276476 3300005468 Bacteria 1632
25 Ga0070707_100575230 3300005468 Bacteria 1089
26 Ga0070707_100700781 3300005468 Bacteria 975
27 Ga0070707_101283663 3300005468 Bacteria 698
28 Ga0070698_100002342 3300005471 Bacteria 20944
29 Ga0070698_100002690 3300005471 Bacteria 19569
30 Ga0070698_100028108 3300005471 Bacteria 5845
31 Ga0070698_100111037 3300005471 Bacteria 2706
32 Ga0070699_100000370 3300005518 Bacteria 44000
33 Ga0070699_100010282 3300005518 Bacteria 8092
34 Ga0070699_100199485 3300005518 Bacteria 1779
35 Ga0070697_100028255 3300005536 Bacteria 4491
36 Ga0070697_100090922 3300005536 Bacteria 2523
37 Ga0070697_100183215 3300005536 Bacteria 1775
38 Ga0070697_100341654 3300005536 Bacteria 1292
39 Ga0070697_100343231 3300005536 Bacteria 1289
40 Ga0070697_100402081 3300005536 Bacteria 1189
41 Ga0070695_100054845 3300005545 Bacteria 2567
42 Ga0070695_100675661 3300005545 Bacteria 817
43 Ga0070665_100034562 3300005548 Bacteria 5083
44 Ga0068855_100228844 3300005563 Bacteria 2083
45 Ga0068855_100511891 3300005563 Bacteria 1303
46 Ga0070664_101246725 3300005564 Bacteria 702
47 Ga0068856_100207515 3300005614 Bacteria 1974
48 Ga0068856_100866678 3300005614 Bacteria 922
49 Ga0068859_100139446 3300005617 Bacteria 2498
50 Ga0068859_100520941 3300005617 Bacteria 1284
51 Ga0068861_100392661 3300005719 Bacteria 1229
52 Ga0068858_100647469 3300005842 Bacteria 1027
53 Ga0068858_101399740 3300005842 Bacteria 689
54 Ga0081455_10424376 3300005937 Bacteria 916
55 Ga0081539_10003132 3300005985 Bacteria 21091
56 Ga0081539_10169982 3300005985 Bacteria 1032
57 Ga0070717_10000025 3300006028 Bacteria 152153
58 Ga0075431_100100107 3300006847 Bacteria 2990
59 Ga0075431_100832407 3300006847 Bacteria 895
60 Ga0075433_10232041 3300006852 Bacteria 1639
61 Ga0075433_10324689 3300006852 Bacteria 1361
62 Ga0075434_100000999 3300006871 Bacteria 22949
63 Ga0075434_100065406 3300006871 Bacteria 3621
64 Ga0075429_100041379 3300006880 Bacteria 4013
65 Ga0075436_100015457 3300006914 Bacteria 5226
66 Ga0075436_100185651 3300006914 Bacteria 1470
67 Ga0097620_100139448 3300006931 Bacteria 2498
68 Ga0097620_100520985 3300006931 Bacteria 1284
69 Ga0075435_100005309 3300007076 Bacteria 8975
70 Ga0075435_100110069 3300007076 Bacteria 2290
71 Ga0111539_10031748 3300009094 Bacteria 6417
72 Ga0114129_10001931 3300009147 Bacteria 28347
73 Ga0114129_10441249 3300009147 Bacteria 1709
74 Ga0105237_10002582 3300009545 Bacteria 22325
75 Ga0105238_10378133 3300009551 Bacteria 1407
76 Ga0105239_10005031 3300010375 Bacteria 15611
77 Ga0105246_11470028 3300011119 Bacteria 639
78 Ga0157370_11043883 3300013104 Bacteria 739
79 Ga0163162_11379932 3300013306 Bacteria 801
80 Ga0157375_10432049 3300013308 Bacteria 1483
81 Ga0157376_10072383 3300014969 Bacteria 2932
82 Ga0206352_10677562 3300020078 Bacteria 633
83 Ga0207653_10047721 3300025885 Bacteria 1419
84 Ga0207685_10746024 3300025905 Bacteria 536
85 Ga0207684_10000035 3300025910 Bacteria 289353
86 Ga0207684_10144641 3300025910 Bacteria 2045
87 Ga0207684_10232179 3300025910 Bacteria 1592
88 Ga0207684_10781268 3300025910 Bacteria 808
89 Ga0207671_10003373 3300025914 Bacteria 15993
90 Ga0207646_10000063 3300025922 Bacteria 150574
91 Ga0207646_10000127 3300025922 Bacteria 103693
92 Ga0207646_10014472 3300025922 Bacteria 7491
93 Ga0207646_10042625 3300025922 Bacteria 4076
94 Ga0207646_10044152 3300025922 Bacteria 4000
95 Ga0207646_10067569 3300025922 Bacteria 3191
96 Ga0207646_10076192 3300025922 Bacteria 2997
97 Ga0207646_10084186 3300025922 Bacteria 2845
98 Ga0207646_10238424 3300025922 Bacteria 1643
99 Ga0207646_10594365 3300025922 Bacteria 994
100 Ga0207659_10303190 3300025926 Bacteria 1313
101 Ga0207687_10572205 3300025927 Bacteria 950
102 Ga0207664_10425989 3300025929 Bacteria 1183
103 Ga0207706_11030907 3300025933 Bacteria 690
104 Ga0207709_10325908 3300025935 Bacteria 1151
105 Ga0207669_10513496 3300025937 Bacteria 961
106 Ga0207691_10089213 3300025940 Bacteria 2765
107 Ga0207689_10445722 3300025942 Bacteria 1082
108 Ga0207703_10753269 3300026035 Bacteria 928
109 Ga0207702_10635610 3300026078 Bacteria 1049
110 Ga0207648_10923462 3300026089 Bacteria 816
111 Ga0207428_10099942 3300027907 Bacteria 2242
112 Ga0268266_10000677 3300028379 Bacteria 46024
113 Ga0307515_10000032 3300028794 Bacteria 358317
114 Ga0307407_10158468 3300031903 Bacteria 1479
115 Ga0307409_100339453 3300031995 Bacteria 1413
116 Ga0307416_100676903 3300032002 Bacteria 1119
117 Ga0307510_10418753 3300033180 Bacteria 782
118 Ga0373933_0331584 3300035724 Bacteria 987
119 Ga0395899_0060972 3300037312 Bacteria 2778
120 Ga0395900_0038612 3300037418 Bacteria 4922
121 Ga0395898_0025455 3300037466 Bacteria 5962
122 Ga0395905_0030920 3300037471 Bacteria 5042
123 Ga0395901_0041652 3300038443 Bacteria 4760
124 Ga0395901_0044302 3300038443 Bacteria 4615
125 Ga0436363_1556195 3300039450 Bacteria 662
126 Ga0439453_0183714 3300041408 Bacteria 511
127 Ga0451851_0297551 3300041507 Bacteria 925
128 Ga0450900_029012 3300042136 Bacteria 798
129 Ga0439458_0009041 3300042157 Bacteria 2221
130 Ga0466969_0045254 3300044656 Bacteria 2186
131 Ga0466972_0069700 3300044658 Bacteria 1678
132 Ga0453683_0132743 3300044673 Bacteria 1570
133 Ga0453683_0287263 3300044673 Bacteria 1051
134 Ga0453683_0549480 3300044673 Bacteria 751
135 Ga0466966_0012530 3300044684 Bacteria 5617
136 Ga0466961_0007198 3300044693 Bacteria 7077
137 Ga0466961_0025279 3300044693 Bacteria 3819
138 Ga0466971_0034009 3300044719 Bacteria 2284
139 Ga0466968_0393660 3300044735 Bacteria 678
140 Ga0466959_0583041 3300045049 Bacteria 753
141 Ga0451576_0027970 3300045051 Bacteria 6046
142 Ga0495594_0089759 3300046499 Bacteria 1722
143 Ga0495594_0628211 3300046499 Bacteria 608
144 Ga0495609_0186088 3300046538 Bacteria 873
145 Ga0495613_0344668 3300046689 Bacteria 1024
146 Ga0495683_0426805 3300047323 Bacteria 547
147 Ga0495626_0006952 3300048091 Bacteria 6370
148 Ga0496104_0092688 3300048907 Bacteria 2889
149 Ga0496107_0755717 3300048910 Bacteria 713
150 Ga0496108_0019123 3300048911 Bacteria 5621
151 Ga0496108_0417299 3300048911 Bacteria 1172
152 Ga0496109_0115896 3300048912 Bacteria 2493
153 Ga0496112_0416717 3300048915 Bacteria 1282
154 Ga0496112_0530560 3300048915 Bacteria 1111
155 Ga0496112_1116809 3300048915 Bacteria 706
156 Ga0496113_0647850 3300048916 Bacteria 845
157 Ga0496114_0424714 3300048917 Bacteria 1177
158 Ga0496115_0663960 3300048918 Bacteria 823
159 Ga0501046_0484813 3300049580 Bacteria 887
160 Ga0501047_0019830 3300049581 Bacteria 6454
161 nmdc:mga05p37_5027_c1 3300050507 Bacteria 15495
162 nmdc:mga09592_78587_c1 3300050508 Bacteria 2808
163 nmdc:mga0qj67_133212_c1 3300050509 Bacteria 2013
164 nmdc:mga06r32_108902_c1 3300050510 Bacteria 2724
165 nmdc:mga06r32_792534_c1 3300050510 Bacteria 909
166 nmdc:mga08y16_152495_c1 3300050511 Bacteria 2402
167 nmdc:mga0n895_4048_c1 3300050512 Bacteria 11929
168 nmdc:mga0rr50_62654_c1 3300050513 Bacteria 2807
169 nmdc:mga08x19_278064_c1 3300050514 Bacteria 1160
170 nmdc:mga08x19_41345_c1 3300050514 Bacteria 2936
171 nmdc:mga08x19_89951_c1 3300050514 Bacteria 2025
172 Ga0500568_0000930 3300053139 Bacteria 20198
173 Ga0501084_0080473 3300054114 Bacteria 2732
174 2753300389 2751185788 Bacteria 4541048
175 2919469017 2919468124 Bacteria 9133025
176 8048412485 8048406513 Bacteria 8936924
177 Ga0070699_100106088
178 Ga0065707_10035626
179 Ga0070676_10688288
180 Ga0068869_101324258
181 Ga0068868_100560812
182 Ga0070668_100685405
183 Ga0070673_100269141
184 Ga0070667_100261082
185 Ga0070714_100175080
186 Ga0070714_101060969
187 Ga0070705_100756924
188 Ga0070694_100324011
189 Ga0070708_100001132
190 Ga0070708_100037160
191 Ga0070708_100089701
192 Ga0070708_100602819
193 Ga0070706_100000319
194 Ga0070706_100018847
195 Ga0070706_100212975
196 Ga0070707_100007804
197 Ga0070707_100014962
198 Ga0070707_100024357
199 Ga0070707_100230827
200 Ga0070707_100276476
201 Ga0070707_100575230
202 Ga0070707_100700781
203 Ga0070707_101283663
204 Ga0070698_100002342
205 Ga0070698_100002690
206 Ga0070698_100028108
207 Ga0070698_100111037
208 Ga0070699_100000370
209 Ga0070699_100010282
210 Ga0070699_100199485
211 Ga0070697_100028255
212 Ga0070697_100090922
213 Ga0070697_100183215
214 Ga0070697_100341654
215 Ga0070697_100343231
216 Ga0070697_100402081
217 Ga0070695_100054845
218 Ga0070695_100675661
219 Ga0070665_100034562
220 Ga0068855_100228844
221 Ga0068855_100511891
222 Ga0070664_101246725
223 Ga0068856_100207515
224 Ga0068856_100866678
225 Ga0068859_100139446
226 Ga0068859_100520941
227 Ga0068861_100392661
228 Ga0068858_100647469
229 Ga0068858_101399740
230 Ga0081455_10424376
231 Ga0081539_10003132
232 Ga0081539_10169982
233 Ga0070717_10000025
234 Ga0075431_100100107
235 Ga0075431_100832407
236 Ga0075433_10232041
237 Ga0075433_10324689
238 Ga0075434_100000999
239 Ga0075434_100065406
240 Ga0075429_100041379
241 Ga0075436_100015457
242 Ga0075436_100185651
243 Ga0097620_100139448
244 Ga0097620_100520985
245 Ga0075435_100005309
246 Ga0075435_100110069
247 Ga0111539_10031748
248 Ga0114129_10001931
249 Ga0114129_10441249
250 Ga0105237_10002582
251 Ga0105238_10378133
252 Ga0105239_10005031
253 Ga0105246_11470028
254 Ga0157370_11043883
255 Ga0163162_11379932
256 Ga0157375_10432049
257 Ga0157376_10072383
258 Ga0206352_10677562
259 Ga0207653_10047721
260 Ga0207685_10746024
261 Ga0207684_10000035
262 Ga0207684_10144641
263 Ga0207684_10232179
264 Ga0207684_10781268
265 Ga0207671_10003373
266 Ga0207646_10000063
267 Ga0207646_10000127
268 Ga0207646_10014472
269 Ga0207646_10042625
270 Ga0207646_10044152
271 Ga0207646_10067569
272 Ga0207646_10076192
273 Ga0207646_10084186
274 Ga0207646_10238424
275 Ga0207646_10594365
276 Ga0207659_10303190
277 Ga0207687_10572205
278 Ga0207664_10425989
279 Ga0207706_11030907
280 Ga0207709_10325908
281 Ga0207669_10513496
282 Ga0207691_10089213
283 Ga0207689_10445722
284 Ga0207703_10753269
285 Ga0207702_10635610
286 Ga0207648_10923462
287 Ga0207428_10099942
288 Ga0268266_10000677
289 Ga0307515_10000032
290 Ga0307407_10158468
291 Ga0307409_100339453
292 Ga0307416_100676903
293 Ga0307510_10418753
294 Ga0373933_0331584
295 Ga0395899_0060972
296 Ga0395900_0038612
297 Ga0395898_0025455
298 Ga0395905_0030920
299 Ga0395901_0041652
300 Ga0395901_0044302
301 Ga0436363_1556195
302 Ga0439453_0183714
303 Ga0451851_0297551
304 Ga0450900_029012
305 Ga0439458_0009041
306 Ga0466969_0045254
307 Ga0466972_0069700
308 Ga0453683_0132743
309 Ga0453683_0287263
310 Ga0453683_0549480
311 Ga0466966_0012530
312 Ga0466961_0007198
313 Ga0466961_0025279
314 Ga0466971_0034009
315 Ga0466968_0393660
316 Ga0466959_0583041
317 Ga0451576_0027970
318 Ga0495594_0089759
319 Ga0495594_0628211
320 Ga0495609_0186088
321 Ga0495613_0344668
322 Ga0495683_0426805
323 Ga0495626_0006952
324 Ga0496104_0092688
325 Ga0496107_0755717
326 Ga0496108_0019123
327 Ga0496108_0417299
328 Ga0496109_0115896
329 Ga0496112_0416717
330 Ga0496112_0530560
331 Ga0496112_1116809
332 Ga0496113_0647850
333 Ga0496114_0424714
334 Ga0496115_0663960
335 Ga0501046_0484813
336 Ga0501047_0019830
337 nmdc:mga05p37_5027_c1
338 nmdc:mga09592_78587_c1
339 nmdc:mga0qj67_133212_c1
340 nmdc:mga06r32_108902_c1
341 nmdc:mga06r32_792534_c1
342 nmdc:mga08y16_152495_c1
343 nmdc:mga0n895_4048_c1
344 nmdc:mga0rr50_62654_c1
345 nmdc:mga08x19_278064_c1
346 nmdc:mga08x19_41345_c1
347 nmdc:mga08x19_89951_c1
348 Ga0500568_0000930
349 Ga0501084_0080473
350 2753300389
351 2919469017
352 8048412485

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6oyc-assembly4.cif.gz_A glycosylation associate protein (gap123) complex from streptococcus agalactiae 0.6815 67 105
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.6786 38 134
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.6245 41 132
2fki-assembly1.cif.gz_A nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 0.6242 55 137
5vae-assembly5.cif.gz_E crystal structure of accessory secretion protein 1 and 3 0.5653 57 106
ID Description Score Start End Superfamily
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7522 37 142 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6993 37 142 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.666 38 135 3.90.1150.200
af_Q6Z4I1_66_215_3.30.540.10 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.6512 76 108 3.30.540.10
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6279 55 140 3.90.1150.30
ID Description Score Start End GO Terms
AF-A0A7W1IU15-F1-model_v4 DUF1801 domain-containing protein 0.9945 32 142
AF-A0A518WQN6-F1-model_v4 DUF1801 domain-containing protein 0.9908 30 142
AF-A0A4U0HJV7-F1-model_v4 DUF1801 domain-containing protein 0.9866 21 142
AF-G8NAC1-F1-model_v4 deleted 0.9858 32 141
AF-T1D9R0-F1-model_v4 Protein containing DUF1801 0.9855 32 95

Map