F267847

General Info

Members Datasets Scaffolds Average Seq Length
176 134 174 81

Family's Representative Sequence

Representative Sequence 3300005459|Ga0068867_101893807|Ga0068867_1018938071
Length 87
Sequence VTARVVLYGKPGCHLCEDARTVVEQVCDELGESFDEVDITAGPDAEALTRAYGEEIPVTFVDGRQHDFWRVDPGRLRAALGAPPRPR

Samples

Sample ID Description Type Environment
1 2643221696 Nocardioides sp. Root140 Isolate Unclassified
2 2739367898 Nocardioides sp. CF479 Isolate Unclassified
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
38 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
39 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
53 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
54 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
55 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
56 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
57 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
58 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
59 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
60 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
61 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
62 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
63 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
64 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
65 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
66 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
67 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
68 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
69 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
70 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
71 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
72 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
73 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
74 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
75 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
76 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
77 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
78 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
79 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
80 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
81 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
82 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
83 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
84 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
85 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
86 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
87 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
88 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
89 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
90 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
91 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
92 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
93 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
94 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
95 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
96 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
97 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
98 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
99 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
100 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
101 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
102 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
103 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
104 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
105 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
108 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
109 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
110 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
119 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
120 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
121 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
122 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
123 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
124 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
125 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
126 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
128 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
129 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
130 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
131 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
132 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
133 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
134 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.73
Metatranscriptomes 1.14
Isolates 1.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.7
Nodule 0
Rhizoplane 16.48
Rhizosphere 76.7
Stem 0
Stem Tuber 0
Unclassified 5.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100957179 3300005330 Bacteria 672
2 Ga0070682_101564474 3300005337 Bacteria 569
3 Ga0070668_101305472 3300005347 Bacteria 660
4 Ga0070674_101899909 3300005356 Bacteria 541
5 Ga0070659_100728619 3300005366 Bacteria 859
6 Ga0070701_10061582 3300005438 Bacteria 1979
7 Ga0070700_100185238 3300005441 Bacteria 1452
8 Ga0070663_100562115 3300005455 Bacteria 955
9 Ga0070678_102286148 3300005456 Bacteria 513
10 Ga0068867_101893807 3300005459 Bacteria 562
11 Ga0070684_100290489 3300005535 Bacteria 1499
12 Ga0070696_101641412 3300005546 Bacteria 553
13 Ga0070664_100392816 3300005564 Bacteria 1268
14 Ga0070664_101017320 3300005564 Bacteria 779
15 Ga0068854_100741813 3300005578 Bacteria 851
16 Ga0068852_100361440 3300005616 Bacteria 1420
17 Ga0068866_10676687 3300005718 Bacteria 705
18 Ga0068861_100082502 3300005719 Bacteria 2520
19 Ga0068870_11315754 3300005840 Bacteria 527
20 Ga0075365_10044969 3300006038 Bacteria 2895
21 Ga0075363_100338294 3300006048 Bacteria 877
22 Ga0070716_101087862 3300006173 Bacteria 637
23 Ga0075428_100010137 3300006844 Bacteria 10469
24 Ga0111539_10256223 3300009094 Bacteria 2037
25 Ga0105245_10347915 3300009098 Bacteria 1468
26 Ga0105245_12422643 3300009098 Bacteria 578
27 Ga0105243_10746854 3300009148 Bacteria 959
28 Ga0105248_12623378 3300009177 Bacteria 574
29 Ga0105238_11303991 3300009551 Bacteria 752
30 Ga0105249_10560554 3300009553 Bacteria 1194
31 Ga0105246_10075137 3300011119 Bacteria 2391
32 Ga0157369_12043359 3300013105 Bacteria 581
33 Ga0157374_11082922 3300013296 Bacteria 822
34 Ga0163162_12811812 3300013306 Bacteria 560
35 Ga0157372_11498986 3300013307 Bacteria 777
36 Ga0157375_10611348 3300013308 Bacteria 1248
37 Ga0157375_11049999 3300013308 Bacteria 952
38 Ga0157375_12610372 3300013308 Bacteria 604
39 Ga0157380_10226996 3300014326 Bacteria 1674
40 Ga0157380_11822393 3300014326 Bacteria 668
41 Ga0182008_10005279 3300014497 Bacteria 7385
42 Ga0206353_10191118 3300020082 Bacteria 972
43 Ga0206353_11060144 3300020082 Bacteria 6969
44 Ga0207688_10992732 3300025901 Bacteria 531
45 Ga0207705_10133379 3300025909 Bacteria 1850
46 Ga0207649_10796653 3300025920 Bacteria 737
47 Ga0207690_10514605 3300025932 Bacteria 969
48 Ga0207690_11604896 3300025932 Bacteria 544
49 Ga0207709_10464488 3300025935 Bacteria 981
50 Ga0207670_11541142 3300025936 Bacteria 565
51 Ga0207661_10050358 3300025944 Bacteria 3318
52 Ga0207679_10812670 3300025945 Bacteria 853
53 Ga0207679_10931914 3300025945 Bacteria 795
54 Ga0207668_11551066 3300025972 Bacteria 598
55 Ga0207708_10017409 3300026075 Bacteria 5409
56 Ga0207708_10764166 3300026075 Bacteria 830
57 Ga0207702_11468507 3300026078 Bacteria 675
58 Ga0207675_100053880 3300026118 Bacteria 3753
59 Ga0307408_101851265 3300031548 Bacteria 578
60 Ga0307408_101950897 3300031548 Bacteria 564
61 Ga0307508_10848725 3300031616 Bacteria 535
62 Ga0307516_10130184 3300031730 Bacteria 2297
63 Ga0307405_10617044 3300031731 Bacteria 887
64 Ga0307405_12064480 3300031731 Bacteria 511
65 Ga0307413_10454175 3300031824 Bacteria 1018
66 Ga0307410_10321322 3300031852 Bacteria 1228
67 Ga0307410_10459411 3300031852 Bacteria 1040
68 Ga0307406_10780748 3300031901 Bacteria 805
69 Ga0307406_11311736 3300031901 Bacteria 632
70 Ga0307407_10020359 3300031903 Bacteria 3398
71 Ga0307412_10616503 3300031911 Bacteria 921
72 Ga0307409_100213221 3300031995 Bacteria 1737
73 Ga0307409_100241771 3300031995 Bacteria 1644
74 Ga0307409_100360034 3300031995 Bacteria 1376
75 Ga0307409_101707850 3300031995 Bacteria 658
76 Ga0307409_101838233 3300031995 Bacteria 635
77 Ga0307416_100083136 3300032002 Bacteria 2715
78 Ga0307416_100566947 3300032002 Bacteria 1211
79 Ga0307411_11141662 3300032005 Bacteria 704
80 Ga0307415_102150484 3300032126 Bacteria 545
81 Ga0307415_102414606 3300032126 Bacteria 517
82 Ga0373928_0206504 3300035084 Bacteria 569
83 Ga0373949_0107456 3300035090 Bacteria 771
84 Ga0373925_1483747 3300037068 Bacteria 555
85 Ga0395905_0548166 3300037471 Bacteria 1058
86 Ga0395901_0444489 3300038443 Bacteria 1327
87 Ga0436365_1444580 3300039437 Bacteria 1055
88 Ga0439465_0166749 3300041413 Bacteria 792
89 Ga0451807_1466171 3300041486 Bacteria 507
90 Ga0451807_2710501 3300041486 Bacteria 551
91 Ga0451833_0577129 3300041491 Bacteria 1431
92 Ga0451837_0538431 3300041494 Bacteria 674
93 Ga0451843_1637080 3300041509 Bacteria 722
94 Ga0451853_3494438 3300041512 Bacteria 536
95 Ga0439442_159865 3300042002 Bacteria 503
96 Ga0466966_0009134 3300044684 Bacteria 6565
97 Ga0466970_0106459 3300044765 Bacteria 1530
98 Ga0466970_0493174 3300044765 Bacteria 705
99 Ga0466957_0037544 3300044842 Bacteria 2917
100 Ga0466960_0216252 3300044901 Bacteria 1053
101 Ga0466960_0408491 3300044901 Bacteria 783
102 Ga0466959_0022068 3300045049 Bacteria 4702
103 Ga0466958_0139375 3300045836 Bacteria 1526
104 Ga0466967_0029706 3300045976 Bacteria 4578
105 Ga0466967_0092243 3300045976 Bacteria 2754
106 Ga0466967_0755536 3300045976 Bacteria 964
107 Ga0495653_0022680 3300046463 Bacteria 5078
108 Ga0495608_0198628 3300046511 Bacteria 1264
109 Ga0495630_0534389 3300046517 Bacteria 899
110 Ga0495640_0921912 3300046533 Bacteria 517
111 Ga0495656_0527768 3300046615 Bacteria 628
112 Ga0495635_0458703 3300046663 Bacteria 842
113 Ga0495658_0588508 3300046683 Bacteria 713
114 Ga0495676_0424177 3300047321 Bacteria 880
115 Ga0495676_0599851 3300047321 Bacteria 717
116 Ga0495680_0769688 3300047322 Bacteria 631
117 Ga0496100_0025995 3300048903 Bacteria 3585
118 Ga0496101_0039940 3300048904 Bacteria 3341
119 Ga0496102_0012687 3300048905 Bacteria 7297
120 Ga0496103_0027702 3300048906 Bacteria 3435
121 Ga0496104_0107611 3300048907 Bacteria 2672
122 Ga0496105_0141273 3300048908 Bacteria 1982
123 Ga0496106_0006617 3300048909 Bacteria 8576
124 Ga0496107_0033494 3300048910 Bacteria 3676
125 Ga0496108_0033635 3300048911 Bacteria 4258
126 Ga0496108_0827779 3300048911 Bacteria 797
127 Ga0496109_0053190 3300048912 Bacteria 3692
128 Ga0496109_0416392 3300048912 Bacteria 1269
129 Ga0496109_1599984 3300048912 Bacteria 586
130 Ga0496110_0119509 3300048913 Bacteria 2373
131 Ga0496110_0182606 3300048913 Bacteria 1905
132 Ga0496110_0799266 3300048913 Bacteria 847
133 Ga0496110_1138681 3300048913 Bacteria 689
134 Ga0496111_0139595 3300048914 Bacteria 1795
135 Ga0496111_1208511 3300048914 Bacteria 535
136 Ga0496112_0122389 3300048915 Bacteria 2572
137 Ga0496112_0459862 3300048915 Bacteria 1210
138 Ga0496113_0033566 3300048916 Bacteria 3738
139 Ga0496113_0788890 3300048916 Bacteria 755
140 Ga0496114_0073973 3300048917 Bacteria 2868
141 Ga0496114_0101198 3300048917 Bacteria 2460
142 Ga0496114_0336544 3300048917 Bacteria 1334
143 Ga0496115_0798655 3300048918 Bacteria 735
144 Ga0501031_0034557 3300049568 Bacteria 3299
145 Ga0501031_0711142 3300049568 Bacteria 645
146 Ga0501032_0856103 3300049569 Bacteria 573
147 Ga0501036_0214266 3300049572 Bacteria 1618
148 Ga0501036_1174184 3300049572 Bacteria 626
149 Ga0501039_0363012 3300049575 Bacteria 1138
150 Ga0501040_0125904 3300049576 Bacteria 1800
151 Ga0501041_0527924 3300049577 Bacteria 752
152 Ga0501042_0551473 3300049578 Bacteria 838
153 Ga0501043_0237791 3300049579 Bacteria 1405
154 Ga0501067_0089589 3300049583 Bacteria 1707
155 Ga0501068_0041302 3300049584 Bacteria 2771
156 Ga0501068_0350592 3300049584 Bacteria 948
157 Ga0501068_0633926 3300049584 Bacteria 697
158 Ga0501069_0137975 3300049585 Bacteria 1398
159 Ga0501069_0211258 3300049585 Bacteria 1126
160 Ga0501071_0720522 3300049587 Bacteria 768
161 Ga0501072_0042798 3300049588 Bacteria 3558
162 Ga0501075_0801138 3300049591 Bacteria 717
163 Ga0501076_0721123 3300049592 Bacteria 823
164 Ga0501080_1645664 3300049742 Bacteria 543
165 Ga0501035_0184947 3300049822 Bacteria 1794
166 Ga0501212_104228 3300049851 Unclassified 536
167 nmdc:mga08y16_219919_c1 3300050511 Bacteria 1966
168 Ga0495619_0952201 3300053085 Bacteria 576
169 Ga0500644_0072123 3300053088 Bacteria 1247
170 Ga0590075_014055 3300059424 Bacteria 1956
171 Ga0501082_0421806 3300060353 Bacteria 1165
172 Ga0466962_0034346 3300061719 Bacteria 2428
173 Ga0530510_0026550 3300061734 Bacteria 4146
174 Ga0530510_0536292 3300061734 Bacteria 888

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046463 Ga0495653_0022680 Ga0495653_0022680_1321_1542 73
2 3300047321 Ga0495676_0599851 Ga0495676_0599851_296_517 73
3 3300031824 Ga0307413_10454175 Ga0307413_104541752 74
4 3300041509 Ga0451843_1637080 Ga0451843_1637080_350_574 74
5 3300044765 Ga0466970_0106459 Ga0466970_0106459_1237_1470 74
6 3300009098 Ga0105245_12422643 Ga0105245_124226431 75
7 3300041486 Ga0451807_1466171 Ga0451807_1466171_270_497 75
8 3300044765 Ga0466970_0493174 Ga0466970_0493174_308_535 75
9 3300044842 Ga0466957_0037544 Ga0466957_0037544_14_268 75
10 3300044901 Ga0466960_0216252 Ga0466960_0216252_300_527 75
11 iso_pu_bacteria 2739367898 2740168311 75
12 3300044684 Ga0466966_0009134 Ga0466966_0009134_3940_4176 76
13 3300045049 Ga0466959_0022068 Ga0466959_0022068_1507_1743 76
14 3300045836 Ga0466958_0139375 Ga0466958_0139375_1161_1397 76
15 3300061719 Ga0466962_0034346 Ga0466962_0034346_1970_2206 76
16 iso_pu_bacteria 2643221696 2644535970 76
17 3300011119 Ga0105246_10075137 Ga0105246_100751373 77
18 3300026075 Ga0207708_10764166 Ga0207708_107641662 77
19 3300049575 Ga0501039_0363012 Ga0501039_0363012_472_705 77
20 3300005337 Ga0070682_101564474 Ga0070682_1015644741 78
21 3300005356 Ga0070674_101899909 Ga0070674_1018999092 78
22 3300005366 Ga0070659_100728619 Ga0070659_1007286192 78
23 3300005456 Ga0070678_102286148 Ga0070678_1022861482 78
24 3300005535 Ga0070684_100290489 Ga0070684_1002904891 78
25 3300005546 Ga0070696_101641412 Ga0070696_1016414121 78
26 3300005564 Ga0070664_100392816 Ga0070664_1003928162 78
27 3300005578 Ga0068854_100741813 Ga0068854_1007418131 78
28 3300005616 Ga0068852_100361440 Ga0068852_1003614402 78
29 3300005718 Ga0068866_10676687 Ga0068866_106766872 78
30 3300006173 Ga0070716_101087862 Ga0070716_1010878622 78
31 3300009098 Ga0105245_10347915 Ga0105245_103479151 78
32 3300009148 Ga0105243_10746854 Ga0105243_107468542 78
33 3300009177 Ga0105248_12623378 Ga0105248_126233782 78
34 3300009553 Ga0105249_10560554 Ga0105249_105605542 78
35 3300013105 Ga0157369_12043359 Ga0157369_120433591 78
36 3300013296 Ga0157374_11082922 Ga0157374_110829221 78
37 3300013307 Ga0157372_11498986 Ga0157372_114989861 78
38 3300013308 Ga0157375_10611348 Ga0157375_106113482 78
39 3300014326 Ga0157380_11822393 Ga0157380_118223932 78
40 3300014497 Ga0182008_10005279 Ga0182008_100052798 78
41 3300020082 Ga0206353_10191118 Ga0206353_101911181 78
42 3300025909 Ga0207705_10133379 Ga0207705_101333792 78
43 3300025920 Ga0207649_10796653 Ga0207649_107966532 78
44 3300025932 Ga0207690_10514605 Ga0207690_105146052 78
45 3300025932 Ga0207690_11604896 Ga0207690_116048961 78
46 3300025935 Ga0207709_10464488 Ga0207709_104644882 78
47 3300025944 Ga0207661_10050358 Ga0207661_100503581 78
48 3300025945 Ga0207679_10812670 Ga0207679_108126701 78
49 3300026078 Ga0207702_11468507 Ga0207702_114685071 78
50 3300031616 Ga0307508_10848725 Ga0307508_108487252 78
51 3300031730 Ga0307516_10130184 Ga0307516_101301843 78
52 3300031995 Ga0307409_100360034 Ga0307409_1003600342 78
53 3300035084 Ga0373928_0206504 Ga0373928_0206504_93_338 78
54 3300035090 Ga0373949_0107456 Ga0373949_0107456_172_417 78
55 3300037068 Ga0373925_1483747 Ga0373925_1483747_58_318 78
56 3300037471 Ga0395905_0548166 Ga0395905_0548166_143_463 78
57 3300038443 Ga0395901_0444489 Ga0395901_0444489_781_1089 78
58 3300042002 Ga0439442_159865 Ga0439442_159865_226_462 78
59 3300046511 Ga0495608_0198628 Ga0495608_0198628_889_1143 78
60 3300046517 Ga0495630_0534389 Ga0495630_0534389_209_469 78
61 3300046533 Ga0495640_0921912 Ga0495640_0921912_59_313 78
62 3300046663 Ga0495635_0458703 Ga0495635_0458703_413_673 78
63 3300046683 Ga0495658_0588508 Ga0495658_0588508_340_585 78
64 3300047321 Ga0495676_0424177 Ga0495676_0424177_216_470 78
65 3300047322 Ga0495680_0769688 Ga0495680_0769688_320_580 78
66 3300048903 Ga0496100_0025995 Ga0496100_0025995_1202_1447 78
67 3300048904 Ga0496101_0039940 Ga0496101_0039940_769_1014 78
68 3300048905 Ga0496102_0012687 Ga0496102_0012687_6693_6938 78
69 3300048906 Ga0496103_0027702 Ga0496103_0027702_1013_1258 78
70 3300048907 Ga0496104_0107611 Ga0496104_0107611_1655_1900 78
71 3300048908 Ga0496105_0141273 Ga0496105_0141273_1227_1472 78
72 3300048909 Ga0496106_0006617 Ga0496106_0006617_6296_6541 78
73 3300048910 Ga0496107_0033494 Ga0496107_0033494_751_996 78
74 3300048911 Ga0496108_0827779 Ga0496108_0827779_537_782 78
75 3300048912 Ga0496109_0416392 Ga0496109_0416392_220_465 78
76 3300048913 Ga0496110_0119509 Ga0496110_0119509_61_306 78
77 3300048913 Ga0496110_0182606 Ga0496110_0182606_194_433 78
78 3300048913 Ga0496110_0799266 Ga0496110_0799266_42_287 78
79 3300048913 Ga0496110_1138681 Ga0496110_1138681_207_446 78
80 3300048914 Ga0496111_0139595 Ga0496111_0139595_445_690 78
81 3300048915 Ga0496112_0122389 Ga0496112_0122389_1258_1503 78
82 3300048916 Ga0496113_0033566 Ga0496113_0033566_1287_1532 78
83 3300048917 Ga0496114_0073973 Ga0496114_0073973_2209_2454 78
84 3300048917 Ga0496114_0101198 Ga0496114_0101198_404_649 78
85 3300048918 Ga0496115_0798655 Ga0496115_0798655_393_638 78
86 3300049568 Ga0501031_0711142 Ga0501031_0711142_170_409 78
87 3300049569 Ga0501032_0856103 Ga0501032_0856103_274_510 78
88 3300049572 Ga0501036_0214266 Ga0501036_0214266_256_495 78
89 3300049576 Ga0501040_0125904 Ga0501040_0125904_536_799 78
90 3300049578 Ga0501042_0551473 Ga0501042_0551473_287_526 78
91 3300049583 Ga0501067_0089589 Ga0501067_0089589_1039_1284 78
92 3300049584 Ga0501068_0041302 Ga0501068_0041302_2055_2300 78
93 3300049584 Ga0501068_0350592 Ga0501068_0350592_11_256 78
94 3300049585 Ga0501069_0137975 Ga0501069_0137975_1043_1288 78
95 3300049585 Ga0501069_0211258 Ga0501069_0211258_268_513 78
96 3300049587 Ga0501071_0720522 Ga0501071_0720522_135_371 78
97 3300049588 Ga0501072_0042798 Ga0501072_0042798_1268_1504 78
98 3300049591 Ga0501075_0801138 Ga0501075_0801138_436_675 78
99 3300049592 Ga0501076_0721123 Ga0501076_0721123_417_653 78
100 3300049742 Ga0501080_1645664 Ga0501080_1645664_13_312 78
101 3300049822 Ga0501035_0184947 Ga0501035_0184947_739_978 78
102 3300053085 Ga0495619_0952201 Ga0495619_0952201_168_422 78
103 3300059424 Ga0590075_014055 Ga0590075_014055_1309_1584 78
104 3300060353 Ga0501082_0421806 Ga0501082_0421806_222_458 78
105 3300061734 Ga0530510_0026550 Ga0530510_0026550_171_416 78
106 3300061734 Ga0530510_0536292 Ga0530510_0536292_603_848 78
107 3300005330 Ga0070690_100957179 Ga0070690_1009571792 79
108 3300005347 Ga0070668_101305472 Ga0070668_1013054721 79
109 3300005438 Ga0070701_10061582 Ga0070701_100615822 79
110 3300005441 Ga0070700_100185238 Ga0070700_1001852383 79
111 3300005455 Ga0070663_100562115 Ga0070663_1005621152 79
112 3300005459 Ga0068867_101893807 Ga0068867_1018938071 79
113 3300005564 Ga0070664_101017320 Ga0070664_1010173202 79
114 3300005719 Ga0068861_100082502 Ga0068861_1000825023 79
115 3300005840 Ga0068870_11315754 Ga0068870_113157541 79
116 3300006038 Ga0075365_10044969 Ga0075365_100449692 79
117 3300006048 Ga0075363_100338294 Ga0075363_1003382942 79
118 3300006844 Ga0075428_100010137 Ga0075428_10001013710 79
119 3300009094 Ga0111539_10256223 Ga0111539_102562232 79
120 3300009551 Ga0105238_11303991 Ga0105238_113039912 79
121 3300013306 Ga0163162_12811812 Ga0163162_128118122 79
122 3300013308 Ga0157375_11049999 Ga0157375_110499992 79
123 3300013308 Ga0157375_12610372 Ga0157375_126103722 79
124 3300014326 Ga0157380_10226996 Ga0157380_102269962 79
125 3300020082 Ga0206353_11060144 Ga0206353_110601447 79
126 3300025901 Ga0207688_10992732 Ga0207688_109927322 79
127 3300025936 Ga0207670_11541142 Ga0207670_115411421 79
128 3300025945 Ga0207679_10931914 Ga0207679_109319142 79
129 3300025972 Ga0207668_11551066 Ga0207668_115510662 79
130 3300026075 Ga0207708_10017409 Ga0207708_100174092 79
131 3300026118 Ga0207675_100053880 Ga0207675_1000538803 79
132 3300031548 Ga0307408_101851265 Ga0307408_1018512651 79
133 3300031548 Ga0307408_101950897 Ga0307408_1019508971 79
134 3300031731 Ga0307405_10617044 Ga0307405_106170442 79
135 3300031731 Ga0307405_12064480 Ga0307405_120644801 79
136 3300031852 Ga0307410_10321322 Ga0307410_103213222 79
137 3300031852 Ga0307410_10459411 Ga0307410_104594111 79
138 3300031901 Ga0307406_10780748 Ga0307406_107807482 79
139 3300031901 Ga0307406_11311736 Ga0307406_113117362 79
140 3300031903 Ga0307407_10020359 Ga0307407_100203593 79
141 3300031911 Ga0307412_10616503 Ga0307412_106165032 79
142 3300031995 Ga0307409_100213221 Ga0307409_1002132211 79
143 3300031995 Ga0307409_100241771 Ga0307409_1002417712 79
144 3300031995 Ga0307409_101707850 Ga0307409_1017078502 79
145 3300031995 Ga0307409_101838233 Ga0307409_1018382332 79
146 3300032002 Ga0307416_100083136 Ga0307416_1000831363 79
147 3300032002 Ga0307416_100566947 Ga0307416_1005669472 79
148 3300032005 Ga0307411_11141662 Ga0307411_111416622 79
149 3300032126 Ga0307415_102150484 Ga0307415_1021504842 79
150 3300032126 Ga0307415_102414606 Ga0307415_1024146062 79
151 3300039437 Ga0436365_1444580 Ga0436365_1444580_395_640 79
152 3300041413 Ga0439465_0166749 Ga0439465_0166749_319_609 79
153 3300041486 Ga0451807_2710501 Ga0451807_2710501_175_414 79
154 3300041491 Ga0451833_0577129 Ga0451833_0577129_988_1239 79
155 3300041494 Ga0451837_0538431 Ga0451837_0538431_367_618 79
156 3300041512 Ga0451853_3494438 Ga0451853_3494438_183_422 79
157 3300044901 Ga0466960_0408491 Ga0466960_0408491_470_736 79
158 3300045976 Ga0466967_0029706 Ga0466967_0029706_2691_2957 79
159 3300045976 Ga0466967_0092243 Ga0466967_0092243_1500_1748 79
160 3300045976 Ga0466967_0755536 Ga0466967_0755536_38_277 79
161 3300046615 Ga0495656_0527768 Ga0495656_0527768_154_402 79
162 3300048911 Ga0496108_0033635 Ga0496108_0033635_871_1113 79
163 3300048912 Ga0496109_0053190 Ga0496109_0053190_2570_2812 79
164 3300048912 Ga0496109_1599984 Ga0496109_1599984_37_276 79
165 3300048914 Ga0496111_1208511 Ga0496111_1208511_134_376 79
166 3300048915 Ga0496112_0459862 Ga0496112_0459862_208_450 79
167 3300048916 Ga0496113_0788890 Ga0496113_0788890_166_408 79
168 3300048917 Ga0496114_0336544 Ga0496114_0336544_1066_1311 79
169 3300049568 Ga0501031_0034557 Ga0501031_0034557_1516_1779 79
170 3300049572 Ga0501036_1174184 Ga0501036_1174184_48_308 79
171 3300049577 Ga0501041_0527924 Ga0501041_0527924_80_322 79
172 3300049579 Ga0501043_0237791 Ga0501043_0237791_826_1083 79
173 3300049584 Ga0501068_0633926 Ga0501068_0633926_121_369 79
174 3300049851 Ga0501212_104228 Ga0501212_104228_135_389 79
175 3300050511 nmdc:mga08y16_219919_c1 nmdc:mga08y16_219919_c1_1353_1598 79
176 3300053088 Ga0500644_0072123 Ga0500644_0072123_740_1000 79

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05768

Glrx-like

Glutaredoxin-like domain (DUF836)

4

81

0.94

PF00462

Glutaredoxin

Glutaredoxin

5

66

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ttz-assembly1.cif.gz_A x-ray structure of northeast structural genomics target protein xcr50 from x. campestris 0.8588 5 78
1xpv-assembly1.cif.gz_A solution structure of northeast structural genomics target protein xcr50 from x. campestris 0.8314 4 78
1wjk-assembly1.cif.gz_A solution structure of hypothetical protein c330018d20rik from mus musculus 0.8215 1 78
2fgx-assembly1.cif.gz_A solution nmr structure of protein ne2328 from nitrosomonas europaea. northeast structural genomics consortium target net3. 0.8197 1 75
1ttz-assembly1.cif.gz_A x-ray structure of northeast structural genomics target protein xcr50 from x. campestris 0.8084 5 78
ID Description Score Start End Superfamily
af_Q54N68_13_94_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9097 5 79 3.40.30.10
af_P9WKS9_1_83_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9014 1 75 3.40.30.10
af_P9WLE7_3_196_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8978 5 36 3.40.30.10
af_Q9VMI0_311_389_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.878 5 79 3.40.30.10
1ttzA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8696 5 78 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7V9MBI0-F1-model_v4 Glutaredoxin family protein 1.004 3 77
AF-A0A7Z0D9N7-F1-model_v4 Glutaredoxin 1.001 2 77
AF-A0A6I5VLE6-F1-model_v4 Glutaredoxin family protein 1.001 3 78
AF-A0A4R7IZ49-F1-model_v4 Glutaredoxin 0.9991 3 78
AF-A0A3G9IFS7-F1-model_v4 Thioredoxin family protein 0.9988 1 79

Feature Viewer

pLDDT pTM Quality
93.85 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map