F267546

General Info

Members Datasets Scaffolds Average Seq Length
176 133 352 117

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10425490|Ga0065715_104254902
Length 134
Sequence MPEETVGRRKPAFVFVEAEMITRLYHNPRCSKSRGALELLRERGIEPQIVAYLDQPPSIAELRELLRLLGTGARSLLRDGEAEYTELGLADPSLDEDALIAAMAAHPRLIERPVFMHAGRAVIGRPPERVLELL

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
32 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
39 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
42 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
43 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
73 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
75 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
76 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
77 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
78 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
79 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
85 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
86 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
87 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
88 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
89 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
90 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
91 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
92 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
93 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
94 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
95 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
96 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
97 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
98 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
99 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
104 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
105 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
106 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
107 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
108 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
109 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
110 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
111 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
112 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
113 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
114 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
115 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
116 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
117 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
118 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
119 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
120 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
121 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
122 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
123 2643221573 Lysobacter sp. Root604 Isolate Unclassified
124 2643221576 Nocardioides sp. Root614 Isolate Unclassified
125 2643221590 Nocardioides sp. Root682 Isolate Unclassified
126 2643221720 Lysobacter sp. Root916 Isolate Unclassified
127 2643221728 Lysobacter sp. Root983 Isolate Unclassified
128 2884411467 Dyella sp. AD56 Isolate Rhizosphere
129 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
130 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
131 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
132 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
133 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.61
Metatranscriptomes 0.57
Isolates 6.82

Biome Distribution

Category Percentage (%)
Aerial Root 0.57
Bulb 0
Endosphere 19.32
Nodule 0
Rhizoplane 2.27
Rhizosphere 72.16
Stem 0
Stem Tuber 0
Unclassified 3.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10425490 3300005293 Bacteria 838
2 JGI25151J46595_10051664 3300003187 Bacteria 1389
3 Ga0055533_1000487 3300003756 Bacteria 14705
4 Ga0055526_1020485 3300003771 Bacteria 2351
5 Ga0055524_1002337 3300003775 Bacteria 9862
6 Ga0055536_1012459 3300003781 Bacteria 3153
7 Ga0055536_1019919 3300003781 Bacteria 2091
8 Ga0055536_1032231 3300003781 Bacteria 1358
9 Ga0055528_1031755 3300003790 Bacteria 1365
10 Ga0055531_10002337 3300003794 Bacteria 12774
11 Ga0055531_10003541 3300003794 Bacteria 9920
12 Ga0055531_10018776 3300003794 Bacteria 2836
13 Ga0055531_10067497 3300003794 Bacteria 840
14 Ga0065715_10097692 3300005293 Bacteria 3666
15 Ga0070658_10024625 3300005327 Bacteria 4826
16 Ga0070658_11469631 3300005327 Bacteria 591
17 Ga0070670_100077920 3300005331 Bacteria 2847
18 Ga0070680_100101561 3300005336 Bacteria 2388
19 Ga0070680_100255343 3300005336 Bacteria 1482
20 Ga0070682_100940147 3300005337 Bacteria 713
21 Ga0068868_101606657 3300005338 Bacteria 611
22 Ga0070687_100346820 3300005343 Bacteria 957
23 Ga0070661_101592205 3300005344 Bacteria 552
24 Ga0070675_101254205 3300005354 Bacteria 683
25 Ga0070671_100009393 3300005355 Bacteria 7853
26 Ga0070671_100204185 3300005355 Bacteria 1676
27 Ga0070659_100507956 3300005366 Bacteria 1028
28 Ga0070659_100714992 3300005366 Bacteria 867
29 Ga0070659_100938234 3300005366 Bacteria 758
30 Ga0070700_100327281 3300005441 Bacteria 1128
31 Ga0070662_100468648 3300005457 Bacteria 1047
32 Ga0070662_100747472 3300005457 Bacteria 829
33 Ga0070679_100132419 3300005530 Bacteria 2474
34 Ga0070672_100006734 3300005543 Bacteria 7750
35 Ga0070664_101165470 3300005564 Bacteria 726
36 Ga0070664_101605736 3300005564 Unclassified 616
37 Ga0068861_100989662 3300005719 Bacteria 802
38 Ga0068851_10853481 3300005834 Bacteria 568
39 Ga0068862_100199849 3300005844 Bacteria 1802
40 Ga0075363_100082462 3300006048 Bacteria 1760
41 Ga0075364_11093956 3300006051 Bacteria 541
42 Ga0105243_12028196 3300009148 Bacteria 610
43 Ga0105242_11388742 3300009176 Bacteria 729
44 Ga0099796_10459909 3300010159 Bacteria 567
45 Ga0157373_10493584 3300013100 Bacteria 884
46 Ga0157369_10003346 3300013105 Bacteria 19046
47 Ga0157372_10461410 3300013307 Bacteria 1480
48 Ga0157372_10479294 3300013307 Bacteria 1450
49 Ga0157375_10150623 3300013308 Bacteria 2461
50 Ga0209674_100062 3300025226 Bacteria 276316
51 Ga0209258_103208 3300025242 Bacteria 3661
52 Ga0209673_1004204 3300025273 Bacteria 7856
53 Ga0209675_1004336 3300025291 Bacteria 6351
54 Ga0209675_1009750 3300025291 Bacteria 3358
55 Ga0209676_1000628 3300025292 Bacteria 50981
56 Ga0209676_1001617 3300025292 Bacteria 19932
57 Ga0209676_1002318 3300025292 Bacteria 13807
58 Ga0209676_1018655 3300025292 Bacteria 2413
59 Ga0209676_1057843 3300025292 Bacteria 981
60 Ga0209025_1001739 3300025294 Bacteria 26163
61 Ga0209025_1041037 3300025294 Bacteria 1990
62 Ga0209025_1045729 3300025294 Bacteria 1810
63 Ga0209564_1006732 3300025295 Bacteria 6107
64 Ga0209256_1008104 3300025299 Bacteria 4958
65 Ga0209256_1101438 3300025299 Bacteria 595
66 Ga0209257_1001720 3300025304 Bacteria 24483
67 Ga0209257_1002094 3300025304 Bacteria 20980
68 Ga0209257_1003480 3300025304 Bacteria 13439
69 Ga0207682_10313752 3300025893 Unclassified 736
70 Ga0207705_10035948 3300025909 Bacteria 3545
71 Ga0207660_10067796 3300025917 Bacteria 2586
72 Ga0207660_10113655 3300025917 Bacteria 2041
73 Ga0207657_10316942 3300025919 Bacteria 1234
74 Ga0207657_10934533 3300025919 Bacteria 667
75 Ga0207652_11006962 3300025921 Bacteria 732
76 Ga0207659_10844765 3300025926 Unclassified 787
77 Ga0207690_10794996 3300025932 Bacteria 782
78 Ga0207706_10390832 3300025933 Bacteria 1207
79 Ga0207709_11445617 3300025935 Bacteria 570
80 Ga0207669_10014290 3300025937 Bacteria 3975
81 Ga0207691_10011792 3300025940 Bacteria 8388
82 Ga0207661_11442534 3300025944 Unclassified 631
83 Ga0207658_10719738 3300025986 Bacteria 903
84 Ga0207677_10901030 3300026023 Bacteria 797
85 Ga0207675_102684407 3300026118 Bacteria 507
86 Ga0207683_10392126 3300026121 Bacteria 1277
87 Ga0209973_1065314 3300027252 Bacteria 564
88 Ga0209371_1011651 3300027312 Bacteria 2596
89 Ga0209967_1038531 3300027364 Bacteria 724
90 Ga0209984_1002516 3300027424 Bacteria 2055
91 Ga0210000_1015050 3300027462 Bacteria 1162
92 Ga0209999_1024283 3300027543 Bacteria 1118
93 Ga0209982_1027424 3300027552 Bacteria 889
94 Ga0209983_1000788 3300027665 Bacteria 6884
95 Ga0209971_1014698 3300027682 Bacteria 1855
96 Ga0209974_10001878 3300027876 Bacteria 7679
97 Ga0268265_10070113 3300028380 Bacteria 2725
98 Ga0268256_1028559 3300030500 Bacteria 1376
99 Ga0265760_10156756 3300031090 Bacteria 749
100 Ga0265340_10451835 3300031247 Archaea 566
101 Ga0307407_10208947 3300031903 Bacteria 1313
102 Ga0307412_10057733 3300031911 Bacteria 2592
103 Ga0307414_10084157 3300032004 Bacteria 2338
104 Ga0307414_10192609 3300032004 Bacteria 1651
105 Ga0307414_10482110 3300032004 Bacteria 1094
106 Ga0307411_10012994 3300032005 Bacteria 4573
107 Ga0395899_0529243 3300037312 Bacteria 761
108 Ga0395900_0196732 3300037418 Bacteria 2042
109 Ga0395900_0233252 3300037418 Bacteria 1850
110 Ga0395898_0516749 3300037466 Bacteria 1135
111 Ga0395898_1203095 3300037466 Bacteria 689
112 Ga0395905_0253063 3300037471 Bacteria 1645
113 Ga0395905_0292894 3300037471 Bacteria 1514
114 Ga0395905_0782502 3300037471 Bacteria 857
115 Ga0395901_0457129 3300038443 Bacteria 1305
116 Ga0439436_0009866 3300041404 Bacteria 2921
117 Ga0439436_0011686 3300041404 Bacteria 2667
118 Ga0439439_0194161 3300041406 Bacteria 588
119 Ga0439447_028237 3300041407 Bacteria 1426
120 Ga0439466_0002133 3300041411 Bacteria 7751
121 Ga0439466_0090853 3300041411 Bacteria 957
122 Ga0439465_0000027 3300041413 Bacteria 29319
123 Ga0439465_0017548 3300041413 Bacteria 2235
124 Ga0439432_036940 3300042006 Bacteria 1561
125 Ga0439432_114128 3300042006 Bacteria 802
126 Ga0439432_200496 3300042006 Bacteria 578
127 Ga0439449_0000093 3300042007 Bacteria 28815
128 Ga0439449_0010491 3300042007 Bacteria 3500
129 Ga0439449_0084875 3300042007 Bacteria 1168
130 Ga0439449_0175186 3300042007 Bacteria 801
131 Ga0439451_001844 3300042009 Bacteria 4236
132 Ga0439451_012752 3300042009 Bacteria 1697
133 Ga0439452_007271 3300042010 Bacteria 3401
134 Ga0439456_013032 3300042013 Bacteria 1728
135 Ga0439456_036648 3300042013 Bacteria 1058
136 Ga0450922_000540 3300042124 Bacteria 4012
137 Ga0466972_0088385 3300044658 Bacteria 1471
138 Ga0466966_0977246 3300044684 Bacteria 511
139 Ga0466961_0124145 3300044693 Bacteria 1620
140 Ga0466963_0571130 3300044694 Bacteria 799
141 Ga0466970_0103549 3300044765 Bacteria 1551
142 Ga0466959_0264899 3300045049 Bacteria 1182
143 Ga0466958_0081078 3300045836 Bacteria 1997
144 Ga0466967_1563257 3300045976 Bacteria 657
145 Ga0495638_0283002 3300046460 Bacteria 900
146 Ga0495650_0008168 3300046471 Bacteria 6157
147 Ga0495632_0163723 3300046519 Bacteria 1023
148 Ga0495598_0000603 3300046537 Bacteria 6803
149 Ga0495621_0504698 3300046539 Unclassified 522
150 Ga0495656_0072170 3300046615 Bacteria 1536
151 Ga0495668_0259137 3300046616 Bacteria 952
152 Ga0495670_0379710 3300046691 Bacteria 762
153 Ga0495671_0010351 3300046692 Bacteria 5171
154 Ga0495602_1053026 3300048088 Unclassified 535
155 Ga0496100_0209559 3300048903 Bacteria 1425
156 Ga0496101_0786771 3300048904 Bacteria 750
157 Ga0496112_0011084 3300048915 Bacteria 8215
158 Ga0496112_0879605 3300048915 Bacteria 819
159 Ga0496118_0102749 3300048921 Bacteria 1925
160 Ga0496121_0000631 3300048924 Bacteria 65738
161 Ga0496124_0061480 3300048927 Bacteria 3148
162 Ga0501202_201151 3300049652 Bacteria 545
163 Ga0501225_0061258 3300049705 Bacteria 1059
164 nmdc:mga03n38_70840_c1 3300050490 Bacteria 1613
165 2510292619 2510065055 Bacteria 5037935
166 2643878813 2643221573 Bacteria 4784121
167 2643889137 2643221576 Bacteria 5214352
168 2643958192 2643221590 Bacteria 5214697
169 2644660129 2643221720 Bacteria 4694283
170 2644697430 2643221728 Bacteria 4797149
171 2884414927 2884411467 Bacteria 5246714
172 2941490818 2941489479 Bacteria 6313767
173 2974299196 2974298342 Bacteria 4840922
174 2984501515 2984499530 Bacteria 5020881
175 2995951233 2995948881 Bacteria 6358104
176 8003016038 8003014200 Bacteria 4059994
177 Ga0065715_10425490
178 JGI25151J46595_10051664
179 Ga0055533_1000487
180 Ga0055526_1020485
181 Ga0055524_1002337
182 Ga0055536_1012459
183 Ga0055536_1019919
184 Ga0055536_1032231
185 Ga0055528_1031755
186 Ga0055531_10002337
187 Ga0055531_10003541
188 Ga0055531_10018776
189 Ga0055531_10067497
190 Ga0065715_10097692
191 Ga0070658_10024625
192 Ga0070658_11469631
193 Ga0070670_100077920
194 Ga0070680_100101561
195 Ga0070680_100255343
196 Ga0070682_100940147
197 Ga0068868_101606657
198 Ga0070687_100346820
199 Ga0070661_101592205
200 Ga0070675_101254205
201 Ga0070671_100009393
202 Ga0070671_100204185
203 Ga0070659_100507956
204 Ga0070659_100714992
205 Ga0070659_100938234
206 Ga0070700_100327281
207 Ga0070662_100468648
208 Ga0070662_100747472
209 Ga0070679_100132419
210 Ga0070672_100006734
211 Ga0070664_101165470
212 Ga0070664_101605736
213 Ga0068861_100989662
214 Ga0068851_10853481
215 Ga0068862_100199849
216 Ga0075363_100082462
217 Ga0075364_11093956
218 Ga0105243_12028196
219 Ga0105242_11388742
220 Ga0099796_10459909
221 Ga0157373_10493584
222 Ga0157369_10003346
223 Ga0157372_10461410
224 Ga0157372_10479294
225 Ga0157375_10150623
226 Ga0209674_100062
227 Ga0209258_103208
228 Ga0209673_1004204
229 Ga0209675_1004336
230 Ga0209675_1009750
231 Ga0209676_1000628
232 Ga0209676_1001617
233 Ga0209676_1002318
234 Ga0209676_1018655
235 Ga0209676_1057843
236 Ga0209025_1001739
237 Ga0209025_1041037
238 Ga0209025_1045729
239 Ga0209564_1006732
240 Ga0209256_1008104
241 Ga0209256_1101438
242 Ga0209257_1001720
243 Ga0209257_1002094
244 Ga0209257_1003480
245 Ga0207682_10313752
246 Ga0207705_10035948
247 Ga0207660_10067796
248 Ga0207660_10113655
249 Ga0207657_10316942
250 Ga0207657_10934533
251 Ga0207652_11006962
252 Ga0207659_10844765
253 Ga0207690_10794996
254 Ga0207706_10390832
255 Ga0207709_11445617
256 Ga0207669_10014290
257 Ga0207691_10011792
258 Ga0207661_11442534
259 Ga0207658_10719738
260 Ga0207677_10901030
261 Ga0207675_102684407
262 Ga0207683_10392126
263 Ga0209973_1065314
264 Ga0209371_1011651
265 Ga0209967_1038531
266 Ga0209984_1002516
267 Ga0210000_1015050
268 Ga0209999_1024283
269 Ga0209982_1027424
270 Ga0209983_1000788
271 Ga0209971_1014698
272 Ga0209974_10001878
273 Ga0268265_10070113
274 Ga0268256_1028559
275 Ga0265760_10156756
276 Ga0265340_10451835
277 Ga0307407_10208947
278 Ga0307412_10057733
279 Ga0307414_10084157
280 Ga0307414_10192609
281 Ga0307414_10482110
282 Ga0307411_10012994
283 Ga0395899_0529243
284 Ga0395900_0196732
285 Ga0395900_0233252
286 Ga0395898_0516749
287 Ga0395898_1203095
288 Ga0395905_0253063
289 Ga0395905_0292894
290 Ga0395905_0782502
291 Ga0395901_0457129
292 Ga0439436_0009866
293 Ga0439436_0011686
294 Ga0439439_0194161
295 Ga0439447_028237
296 Ga0439466_0002133
297 Ga0439466_0090853
298 Ga0439465_0000027
299 Ga0439465_0017548
300 Ga0439432_036940
301 Ga0439432_114128
302 Ga0439432_200496
303 Ga0439449_0000093
304 Ga0439449_0010491
305 Ga0439449_0084875
306 Ga0439449_0175186
307 Ga0439451_001844
308 Ga0439451_012752
309 Ga0439452_007271
310 Ga0439456_013032
311 Ga0439456_036648
312 Ga0450922_000540
313 Ga0466972_0088385
314 Ga0466966_0977246
315 Ga0466961_0124145
316 Ga0466963_0571130
317 Ga0466970_0103549
318 Ga0466959_0264899
319 Ga0466958_0081078
320 Ga0466967_1563257
321 Ga0495638_0283002
322 Ga0495650_0008168
323 Ga0495632_0163723
324 Ga0495598_0000603
325 Ga0495621_0504698
326 Ga0495656_0072170
327 Ga0495668_0259137
328 Ga0495670_0379710
329 Ga0495671_0010351
330 Ga0495602_1053026
331 Ga0496100_0209559
332 Ga0496101_0786771
333 Ga0496112_0011084
334 Ga0496112_0879605
335 Ga0496118_0102749
336 Ga0496121_0000631
337 Ga0496124_0061480
338 Ga0501202_201151
339 Ga0501225_0061258
340 nmdc:mga03n38_70840_c1
341 2510292619
342 2643878813
343 2643889137
344 2643958192
345 2644660129
346 2644697430
347 2884414927
348 2941490818
349 2974299196
350 2984501515
351 2995951233
352 8003016038

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03960

ArsC

ArsC family

25

133

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rdw-assembly2.cif.gz_B putative arsenate reductase from yersinia pestis 0.9606 4 114
3f0i-assembly2.cif.gz_B arsenate reductase from vibrio cholerae. 0.9583 1 115
1i9d-assembly1.cif.gz_A arsenate reductase from e. coli 0.9424 4 115
1j9b-assembly1.cif.gz_A arsenate reductase+0.4m arsenite from e. coli 0.9411 4 116
1s3c-assembly1.cif.gz_A arsenate reductase c12s mutant from e. coli 0.9407 4 116
ID Description Score Start End Superfamily
3rdwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9608 4 114 3.40.30.10
1j9bA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9411 4 116 3.40.30.10
3rdwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9283 4 114 3.40.30.10
2cz3A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9248 7 32 3.40.30.10
af_P0ACA1_1_77_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9166 5 32 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2E3D2C3-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 0.9898 4 114 GO:0008794
AF-A0A7Y3F586-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 0.9866 3 115 GO:0008794
AF-A0A5C1DJ81-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 0.9847 4 117 GO:0008794
AF-A0A3B9XSD2-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 0.9844 4 99 GO:0008794
AF-A0A5C9BY26-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 0.9827 3 115 GO:0008794

Map