F267169
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 175 | 93 | 350 | 295 |
Family's Representative Sequence
| Representative Sequence | 3300049666|Ga0501228_001142|Ga0501228_001142_599_1525 |
| Length | 308 |
| Sequence | METKLPFRGWGYKMSLREKLRGTGVAIITPFKRDQSVDFDALGKLINHIIENGIQYIVSLGTTGEPPVLSKEEKLEVLSFTYAVAAGKVPVVVGISGNNTEALVDEIDSFPLEKAVAVLVASPYYNRPSQEGIFQHYKVVGEASPKPVIVYNVPGRTGSNITAATTVRLAKEIENIAGIKEASGNMVQCMHILRDRPGDFLVVSGDDHITLPLIACGMDGVISVAANCFAKDFCAMVNAALNNNYEKAALLQYKLLEGFDLLFAENNPAGVKAFLKEMGMIENILRLPLVPLSDSIMQQVKKYYPTLK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 13 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 14 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 15 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 16 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 17 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 18 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 19 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 20 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 21 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 22 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 23 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 25 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 26 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 27 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 28 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 29 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 30 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 31 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 50 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 51 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 52 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 53 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 54 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 55 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 56 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 57 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 58 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 59 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 60 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 61 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 62 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 63 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 64 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 65 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 66 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 67 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 68 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 69 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 70 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 71 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 72 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 73 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 74 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 75 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 76 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 77 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 78 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 79 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 80 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 81 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 82 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 83 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 84 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 85 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 86 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 87 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 88 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 89 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 90 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 91 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 92 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 93 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 98.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501228_001142 | 3300049666 | Bacteria | 1877 |
| 2 | Ga0070658_10035506 | 3300005327 | Bacteria | 4016 |
| 3 | Ga0070658_10059802 | 3300005327 | Bacteria | 3103 |
| 4 | Ga0070666_10045559 | 3300005335 | Bacteria | 2940 |
| 5 | Ga0070680_100028845 | 3300005336 | Bacteria | 4453 |
| 6 | Ga0070680_100030798 | 3300005336 | Unclassified | 4310 |
| 7 | Ga0070680_100077707 | 3300005336 | Bacteria | 2734 |
| 8 | Ga0070682_100000031 | 3300005337 | Bacteria | 156874 |
| 9 | Ga0070660_100035879 | 3300005339 | Bacteria | 3754 |
| 10 | Ga0070660_100315698 | 3300005339 | Unclassified | 1283 |
| 11 | Ga0070659_100141472 | 3300005366 | Bacteria | 1959 |
| 12 | Ga0070667_100048248 | 3300005367 | Bacteria | 3584 |
| 13 | Ga0070663_100015838 | 3300005455 | Bacteria | 4878 |
| 14 | Ga0070681_10029338 | 3300005458 | Bacteria | 5524 |
| 15 | Ga0070681_10132041 | 3300005458 | Bacteria | 2429 |
| 16 | Ga0070681_10447613 | 3300005458 | Bacteria | 1203 |
| 17 | Ga0070679_100000517 | 3300005530 | Bacteria | 32752 |
| 18 | Ga0070679_100235938 | 3300005530 | Bacteria | 1788 |
| 19 | Ga0070679_100470953 | 3300005530 | Bacteria | 1200 |
| 20 | Ga0070679_100491263 | 3300005530 | Bacteria | 1172 |
| 21 | Ga0068853_100011899 | 3300005539 | Bacteria | 7077 |
| 22 | Ga0068855_100004342 | 3300005563 | Bacteria | 17337 |
| 23 | Ga0068855_100013894 | 3300005563 | Bacteria | 9710 |
| 24 | Ga0068855_100269251 | 3300005563 | Bacteria | 1895 |
| 25 | Ga0068855_100379237 | 3300005563 | Bacteria | 1553 |
| 26 | Ga0068857_100077127 | 3300005577 | Bacteria | 2973 |
| 27 | Ga0068857_100122149 | 3300005577 | Bacteria | 2346 |
| 28 | Ga0068856_100007328 | 3300005614 | Bacteria | 10768 |
| 29 | Ga0068856_100105576 | 3300005614 | Bacteria | 2811 |
| 30 | Ga0068856_100133107 | 3300005614 | Bacteria | 2491 |
| 31 | Ga0068852_100017930 | 3300005616 | Bacteria | 5567 |
| 32 | Ga0068852_100142204 | 3300005616 | Unclassified | 2222 |
| 33 | Ga0068859_100321198 | 3300005617 | Bacteria | 1642 |
| 34 | Ga0068861_100437148 | 3300005719 | Unclassified | 1169 |
| 35 | Ga0068860_100081456 | 3300005843 | Unclassified | 3078 |
| 36 | Ga0097620_100321191 | 3300006931 | Bacteria | 1642 |
| 37 | Ga0105240_10186428 | 3300009093 | Unclassified | 2443 |
| 38 | Ga0105241_10024819 | 3300009174 | Bacteria | 4454 |
| 39 | Ga0105239_10160340 | 3300010375 | Bacteria | 2513 |
| 40 | Ga0157373_10001300 | 3300013100 | Bacteria | 19057 |
| 41 | Ga0157373_10022053 | 3300013100 | Bacteria | 4621 |
| 42 | Ga0157373_10060696 | 3300013100 | Bacteria | 2678 |
| 43 | Ga0157373_10190116 | 3300013100 | Unclassified | 1447 |
| 44 | Ga0157371_10001322 | 3300013102 | Bacteria | 26019 |
| 45 | Ga0157371_10002423 | 3300013102 | Bacteria | 17819 |
| 46 | Ga0157371_10005106 | 3300013102 | Bacteria | 11198 |
| 47 | Ga0157371_10006032 | 3300013102 | Bacteria | 10088 |
| 48 | Ga0157371_10100876 | 3300013102 | Bacteria | 2048 |
| 49 | Ga0157371_10254056 | 3300013102 | Bacteria | 1266 |
| 50 | Ga0157370_10000994 | 3300013104 | Bacteria | 35770 |
| 51 | Ga0157370_10037598 | 3300013104 | Bacteria | 4691 |
| 52 | Ga0157370_10240158 | 3300013104 | Bacteria | 1676 |
| 53 | Ga0157369_10065389 | 3300013105 | Bacteria | 3913 |
| 54 | Ga0157374_10123811 | 3300013296 | Bacteria | 2497 |
| 55 | Ga0157374_10194160 | 3300013296 | Bacteria | 1986 |
| 56 | Ga0163162_10419181 | 3300013306 | Bacteria | 1471 |
| 57 | Ga0157372_10003873 | 3300013307 | Bacteria | 16080 |
| 58 | Ga0157372_10031100 | 3300013307 | Bacteria | 5844 |
| 59 | Ga0157372_10032879 | 3300013307 | Bacteria | 5692 |
| 60 | Ga0157372_10039878 | 3300013307 | Bacteria | 5185 |
| 61 | Ga0157372_10114815 | 3300013307 | Bacteria | 3087 |
| 62 | Ga0157372_10532285 | 3300013307 | Bacteria | 1370 |
| 63 | Ga0157375_10205124 | 3300013308 | Bacteria | 2128 |
| 64 | Ga0157380_10139619 | 3300014326 | Bacteria | 2080 |
| 65 | Ga0157379_10526706 | 3300014968 | Bacteria | 1097 |
| 66 | Ga0157376_10226696 | 3300014969 | Unclassified | 1734 |
| 67 | Ga0207705_10044123 | 3300025909 | Bacteria | 3204 |
| 68 | Ga0207705_10054291 | 3300025909 | Bacteria | 2888 |
| 69 | Ga0207707_10020054 | 3300025912 | Bacteria | 5833 |
| 70 | Ga0207707_10392868 | 3300025912 | Bacteria | 1191 |
| 71 | Ga0207707_10493729 | 3300025912 | Bacteria | 1045 |
| 72 | Ga0207695_10019935 | 3300025913 | Bacteria | 7701 |
| 73 | Ga0207660_10087103 | 3300025917 | Bacteria | 2307 |
| 74 | Ga0207660_10099496 | 3300025917 | Unclassified | 2170 |
| 75 | Ga0207657_10010980 | 3300025919 | Bacteria | 9002 |
| 76 | Ga0207652_10000101 | 3300025921 | Bacteria | 93033 |
| 77 | Ga0207652_10000616 | 3300025921 | Bacteria | 35409 |
| 78 | Ga0207652_10148453 | 3300025921 | Bacteria | 2099 |
| 79 | Ga0207652_10200813 | 3300025921 | Bacteria | 1794 |
| 80 | Ga0207652_10389791 | 3300025921 | Unclassified | 1257 |
| 81 | Ga0207659_10188037 | 3300025926 | Unclassified | 1641 |
| 82 | Ga0207690_10010867 | 3300025932 | Bacteria | 5424 |
| 83 | Ga0207690_10012101 | 3300025932 | Bacteria | 5160 |
| 84 | Ga0207690_10192829 | 3300025932 | Bacteria | 1542 |
| 85 | Ga0207686_10118822 | 3300025934 | Bacteria | 1796 |
| 86 | Ga0207667_10001154 | 3300025949 | Bacteria | 33200 |
| 87 | Ga0207667_10065194 | 3300025949 | Bacteria | 3800 |
| 88 | Ga0207667_10070779 | 3300025949 | Bacteria | 3629 |
| 89 | Ga0207667_10158318 | 3300025949 | Bacteria | 2330 |
| 90 | Ga0207667_10252275 | 3300025949 | Bacteria | 1805 |
| 91 | Ga0207667_10270720 | 3300025949 | Bacteria | 1736 |
| 92 | Ga0207702_10030862 | 3300026078 | Bacteria | 4465 |
| 93 | Ga0207702_10140907 | 3300026078 | Bacteria | 2182 |
| 94 | Ga0207648_10268643 | 3300026089 | Bacteria | 1523 |
| 95 | Ga0207674_10044639 | 3300026116 | Bacteria | 4565 |
| 96 | Ga0207674_10093958 | 3300026116 | Bacteria | 2986 |
| 97 | Ga0268264_10072782 | 3300028381 | Unclassified | 2915 |
| 98 | Ga0265323_10000876 | 3300028653 | Bacteria | 15945 |
| 99 | Ga0265327_10038825 | 3300031251 | Bacteria | 2593 |
| 100 | Ga0265316_10002088 | 3300031344 | Bacteria | 21010 |
| 101 | Ga0265316_10005269 | 3300031344 | Bacteria | 12620 |
| 102 | Ga0265342_10097817 | 3300031712 | Bacteria | 1676 |
| 103 | Ga0307413_10278323 | 3300031824 | Bacteria | 1257 |
| 104 | Ga0395899_0000159 | 3300037312 | Bacteria | 102831 |
| 105 | Ga0395899_0000526 | 3300037312 | Bacteria | 42013 |
| 106 | Ga0395899_0026332 | 3300037312 | Bacteria | 4388 |
| 107 | Ga0395899_0203114 | 3300037312 | Bacteria | 1380 |
| 108 | Ga0395900_0004043 | 3300037418 | Bacteria | 15651 |
| 109 | Ga0395900_0012551 | 3300037418 | Bacteria | 8668 |
| 110 | Ga0395900_0071618 | 3300037418 | Bacteria | 3563 |
| 111 | Ga0395900_0091777 | 3300037418 | Bacteria | 3120 |
| 112 | Ga0395900_0149634 | 3300037418 | Bacteria | 2385 |
| 113 | Ga0395900_0224403 | 3300037418 | Bacteria | 1892 |
| 114 | Ga0395898_0002043 | 3300037466 | Bacteria | 25263 |
| 115 | Ga0395898_0017368 | 3300037466 | Bacteria | 7350 |
| 116 | Ga0395898_0031136 | 3300037466 | Bacteria | 5334 |
| 117 | Ga0395898_0046996 | 3300037466 | Bacteria | 4238 |
| 118 | Ga0395905_0401154 | 3300037471 | Bacteria | 1266 |
| 119 | Ga0395901_0065186 | 3300038443 | Bacteria | 3792 |
| 120 | Ga0395901_0067947 | 3300038443 | Bacteria | 3713 |
| 121 | Ga0395901_0095322 | 3300038443 | Bacteria | 3118 |
| 122 | Ga0395901_0116866 | 3300038443 | Bacteria | 2802 |
| 123 | Ga0400483_051348 | 3300039062 | Bacteria | 1089 |
| 124 | Ga0436365_0040113 | 3300039437 | Bacteria | 10715 |
| 125 | Ga0451855_1103441 | 3300041511 | Bacteria | 1099 |
| 126 | Ga0451577_0004410 | 3300042876 | Bacteria | 14879 |
| 127 | Ga0451577_0012182 | 3300042876 | Bacteria | 8085 |
| 128 | Ga0451577_0025161 | 3300042876 | Bacteria | 5404 |
| 129 | Ga0451577_0064416 | 3300042876 | Bacteria | 3269 |
| 130 | Ga0451577_0378026 | 3300042876 | Bacteria | 1285 |
| 131 | Ga0453683_0196274 | 3300044673 | Bacteria | 1281 |
| 132 | Ga0453684_0000091 | 3300044712 | Bacteria | 387720 |
| 133 | Ga0453684_0002151 | 3300044712 | Bacteria | 49340 |
| 134 | Ga0453684_0003829 | 3300044712 | Bacteria | 33184 |
| 135 | Ga0453684_0011862 | 3300044712 | Bacteria | 14515 |
| 136 | Ga0453684_0024319 | 3300044712 | Bacteria | 8859 |
| 137 | Ga0453684_0043653 | 3300044712 | Bacteria | 6021 |
| 138 | Ga0453684_0368531 | 3300044712 | Bacteria | 1615 |
| 139 | Ga0453684_0719165 | 3300044712 | Bacteria | 1083 |
| 140 | Ga0453684_0765574 | 3300044712 | Bacteria | 1044 |
| 141 | Ga0451576_0047697 | 3300045051 | Bacteria | 4502 |
| 142 | Ga0451576_0068425 | 3300045051 | Bacteria | 3695 |
| 143 | Ga0451576_0346787 | 3300045051 | Bacteria | 1555 |
| 144 | Ga0451576_0395938 | 3300045051 | Bacteria | 1448 |
| 145 | Ga0451576_0468992 | 3300045051 | Bacteria | 1322 |
| 146 | Ga0495672_0113019 | 3300047320 | Bacteria | 1455 |
| 147 | Ga0501032_0193746 | 3300049569 | Bacteria | 1328 |
| 148 | Ga0501034_0020116 | 3300049571 | Bacteria | 6814 |
| 149 | Ga0501034_0109647 | 3300049571 | Bacteria | 2751 |
| 150 | Ga0501036_0099696 | 3300049572 | Bacteria | 2457 |
| 151 | Ga0501047_0028213 | 3300049581 | Bacteria | 5410 |
| 152 | Ga0501198_002343 | 3300049649 | Unclassified | 2546 |
| 153 | Ga0501201_006552 | 3300049651 | Unclassified | 1104 |
| 154 | Ga0501202_005634 | 3300049652 | Unclassified | 2219 |
| 155 | Ga0501206_005227 | 3300049653 | Unclassified | 1669 |
| 156 | Ga0501207_006638 | 3300049654 | Unclassified | 1631 |
| 157 | Ga0501217_005600 | 3300049661 | Unclassified | 2632 |
| 158 | Ga0501222_002801 | 3300049662 | Unclassified | 2414 |
| 159 | Ga0501223_029221 | 3300049663 | Unclassified | 1072 |
| 160 | Ga0501224_002745 | 3300049664 | Bacteria | 2425 |
| 161 | Ga0501233_005012 | 3300049668 | Bacteria | 2450 |
| 162 | Ga0501235_001146 | 3300049669 | Bacteria | 5566 |
| 163 | Ga0501235_034311 | 3300049669 | Bacteria | 1151 |
| 164 | Ga0501240_013287 | 3300049673 | Unclassified | 1140 |
| 165 | Ga0501242_003265 | 3300049674 | Bacteria | 1748 |
| 166 | Ga0501243_004750 | 3300049675 | Bacteria | 2042 |
| 167 | Ga0501252_005495 | 3300049682 | Unclassified | 1380 |
| 168 | Ga0501259_004748 | 3300049688 | Bacteria | 2155 |
| 169 | Ga0501221_002427 | 3300049704 | Bacteria | 3071 |
| 170 | Ga0501225_0025603 | 3300049705 | Bacteria | 1622 |
| 171 | Ga0501234_003409 | 3300049707 | Bacteria | 2499 |
| 172 | Ga0501245_009593 | 3300049708 | Unclassified | 1391 |
| 173 | Ga0501232_008519 | 3300049757 | Unclassified | 1111 |
| 174 | Ga0501035_0505022 | 3300049822 | Bacteria | 995 |
| 175 | Ga0501212_005910 | 3300049851 | Unclassified | 1635 |
| 176 | Ga0501228_001142 | |||
| 177 | Ga0070658_10035506 | |||
| 178 | Ga0070658_10059802 | |||
| 179 | Ga0070666_10045559 | |||
| 180 | Ga0070680_100028845 | |||
| 181 | Ga0070680_100030798 | |||
| 182 | Ga0070680_100077707 | |||
| 183 | Ga0070682_100000031 | |||
| 184 | Ga0070660_100035879 | |||
| 185 | Ga0070660_100315698 | |||
| 186 | Ga0070659_100141472 | |||
| 187 | Ga0070667_100048248 | |||
| 188 | Ga0070663_100015838 | |||
| 189 | Ga0070681_10029338 | |||
| 190 | Ga0070681_10132041 | |||
| 191 | Ga0070681_10447613 | |||
| 192 | Ga0070679_100000517 | |||
| 193 | Ga0070679_100235938 | |||
| 194 | Ga0070679_100470953 | |||
| 195 | Ga0070679_100491263 | |||
| 196 | Ga0068853_100011899 | |||
| 197 | Ga0068855_100004342 | |||
| 198 | Ga0068855_100013894 | |||
| 199 | Ga0068855_100269251 | |||
| 200 | Ga0068855_100379237 | |||
| 201 | Ga0068857_100077127 | |||
| 202 | Ga0068857_100122149 | |||
| 203 | Ga0068856_100007328 | |||
| 204 | Ga0068856_100105576 | |||
| 205 | Ga0068856_100133107 | |||
| 206 | Ga0068852_100017930 | |||
| 207 | Ga0068852_100142204 | |||
| 208 | Ga0068859_100321198 | |||
| 209 | Ga0068861_100437148 | |||
| 210 | Ga0068860_100081456 | |||
| 211 | Ga0097620_100321191 | |||
| 212 | Ga0105240_10186428 | |||
| 213 | Ga0105241_10024819 | |||
| 214 | Ga0105239_10160340 | |||
| 215 | Ga0157373_10001300 | |||
| 216 | Ga0157373_10022053 | |||
| 217 | Ga0157373_10060696 | |||
| 218 | Ga0157373_10190116 | |||
| 219 | Ga0157371_10001322 | |||
| 220 | Ga0157371_10002423 | |||
| 221 | Ga0157371_10005106 | |||
| 222 | Ga0157371_10006032 | |||
| 223 | Ga0157371_10100876 | |||
| 224 | Ga0157371_10254056 | |||
| 225 | Ga0157370_10000994 | |||
| 226 | Ga0157370_10037598 | |||
| 227 | Ga0157370_10240158 | |||
| 228 | Ga0157369_10065389 | |||
| 229 | Ga0157374_10123811 | |||
| 230 | Ga0157374_10194160 | |||
| 231 | Ga0163162_10419181 | |||
| 232 | Ga0157372_10003873 | |||
| 233 | Ga0157372_10031100 | |||
| 234 | Ga0157372_10032879 | |||
| 235 | Ga0157372_10039878 | |||
| 236 | Ga0157372_10114815 | |||
| 237 | Ga0157372_10532285 | |||
| 238 | Ga0157375_10205124 | |||
| 239 | Ga0157380_10139619 | |||
| 240 | Ga0157379_10526706 | |||
| 241 | Ga0157376_10226696 | |||
| 242 | Ga0207705_10044123 | |||
| 243 | Ga0207705_10054291 | |||
| 244 | Ga0207707_10020054 | |||
| 245 | Ga0207707_10392868 | |||
| 246 | Ga0207707_10493729 | |||
| 247 | Ga0207695_10019935 | |||
| 248 | Ga0207660_10087103 | |||
| 249 | Ga0207660_10099496 | |||
| 250 | Ga0207657_10010980 | |||
| 251 | Ga0207652_10000101 | |||
| 252 | Ga0207652_10000616 | |||
| 253 | Ga0207652_10148453 | |||
| 254 | Ga0207652_10200813 | |||
| 255 | Ga0207652_10389791 | |||
| 256 | Ga0207659_10188037 | |||
| 257 | Ga0207690_10010867 | |||
| 258 | Ga0207690_10012101 | |||
| 259 | Ga0207690_10192829 | |||
| 260 | Ga0207686_10118822 | |||
| 261 | Ga0207667_10001154 | |||
| 262 | Ga0207667_10065194 | |||
| 263 | Ga0207667_10070779 | |||
| 264 | Ga0207667_10158318 | |||
| 265 | Ga0207667_10252275 | |||
| 266 | Ga0207667_10270720 | |||
| 267 | Ga0207702_10030862 | |||
| 268 | Ga0207702_10140907 | |||
| 269 | Ga0207648_10268643 | |||
| 270 | Ga0207674_10044639 | |||
| 271 | Ga0207674_10093958 | |||
| 272 | Ga0268264_10072782 | |||
| 273 | Ga0265323_10000876 | |||
| 274 | Ga0265327_10038825 | |||
| 275 | Ga0265316_10002088 | |||
| 276 | Ga0265316_10005269 | |||
| 277 | Ga0265342_10097817 | |||
| 278 | Ga0307413_10278323 | |||
| 279 | Ga0395899_0000159 | |||
| 280 | Ga0395899_0000526 | |||
| 281 | Ga0395899_0026332 | |||
| 282 | Ga0395899_0203114 | |||
| 283 | Ga0395900_0004043 | |||
| 284 | Ga0395900_0012551 | |||
| 285 | Ga0395900_0071618 | |||
| 286 | Ga0395900_0091777 | |||
| 287 | Ga0395900_0149634 | |||
| 288 | Ga0395900_0224403 | |||
| 289 | Ga0395898_0002043 | |||
| 290 | Ga0395898_0017368 | |||
| 291 | Ga0395898_0031136 | |||
| 292 | Ga0395898_0046996 | |||
| 293 | Ga0395905_0401154 | |||
| 294 | Ga0395901_0065186 | |||
| 295 | Ga0395901_0067947 | |||
| 296 | Ga0395901_0095322 | |||
| 297 | Ga0395901_0116866 | |||
| 298 | Ga0400483_051348 | |||
| 299 | Ga0436365_0040113 | |||
| 300 | Ga0451855_1103441 | |||
| 301 | Ga0451577_0004410 | |||
| 302 | Ga0451577_0012182 | |||
| 303 | Ga0451577_0025161 | |||
| 304 | Ga0451577_0064416 | |||
| 305 | Ga0451577_0378026 | |||
| 306 | Ga0453683_0196274 | |||
| 307 | Ga0453684_0000091 | |||
| 308 | Ga0453684_0002151 | |||
| 309 | Ga0453684_0003829 | |||
| 310 | Ga0453684_0011862 | |||
| 311 | Ga0453684_0024319 | |||
| 312 | Ga0453684_0043653 | |||
| 313 | Ga0453684_0368531 | |||
| 314 | Ga0453684_0719165 | |||
| 315 | Ga0453684_0765574 | |||
| 316 | Ga0451576_0047697 | |||
| 317 | Ga0451576_0068425 | |||
| 318 | Ga0451576_0346787 | |||
| 319 | Ga0451576_0395938 | |||
| 320 | Ga0451576_0468992 | |||
| 321 | Ga0495672_0113019 | |||
| 322 | Ga0501032_0193746 | |||
| 323 | Ga0501034_0020116 | |||
| 324 | Ga0501034_0109647 | |||
| 325 | Ga0501036_0099696 | |||
| 326 | Ga0501047_0028213 | |||
| 327 | Ga0501198_002343 | |||
| 328 | Ga0501201_006552 | |||
| 329 | Ga0501202_005634 | |||
| 330 | Ga0501206_005227 | |||
| 331 | Ga0501207_006638 | |||
| 332 | Ga0501217_005600 | |||
| 333 | Ga0501222_002801 | |||
| 334 | Ga0501223_029221 | |||
| 335 | Ga0501224_002745 | |||
| 336 | Ga0501233_005012 | |||
| 337 | Ga0501235_001146 | |||
| 338 | Ga0501235_034311 | |||
| 339 | Ga0501240_013287 | |||
| 340 | Ga0501242_003265 | |||
| 341 | Ga0501243_004750 | |||
| 342 | Ga0501252_005495 | |||
| 343 | Ga0501259_004748 | |||
| 344 | Ga0501221_002427 | |||
| 345 | Ga0501225_0025603 | |||
| 346 | Ga0501234_003409 | |||
| 347 | Ga0501245_009593 | |||
| 348 | Ga0501232_008519 | |||
| 349 | Ga0501035_0505022 | |||
| 350 | Ga0501212_005910 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6mqh-assembly1.cif.gz_A | crystal structure of 4-hydroxy-tetrahydrodipicolinate synthase (htpa synthase) from burkholderia mallei | 0.9674 | 7 | 295 |
| 3noe-assembly1.cif.gz_A | crystal structure of dihydrodipicolinate synthase from pseudomonas aeruginosa | 0.9672 | 7 | 292 |
| 3flu-assembly1.cif.gz_B | crystal structure of dihydrodipicolinate synthase from the pathogen neisseria meningitidis | 0.9664 | 7 | 293 |
| 6p90-assembly1.cif.gz_B | crystal structure of padhdps2-h56q mutant | 0.9662 | 7 | 292 |
| 3pud-assembly1.cif.gz_A | crystal structure of dhydrodipicolinate synthase from acinetobacter baumannii at 2.8a resolution | 0.9654 | 7 | 292 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3pb2D00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9617 | 4 | 295 | 3.20.20.70 |
| 6nvaA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9602 | 5 | 295 | 3.20.20.70 |
| 2yxgD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.959 | 8 | 295 | 3.20.20.70 |
| 2rfgB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9576 | 7 | 297 | 3.20.20.70 |
| 3a5fA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9575 | 8 | 295 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1PWR2-F1-model_v4 | 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) | 0.9834 | 5 | 230 |
GO:0005829
GO:0008840 GO:0009089 GO:0019877 |
| AF-A3XRN1-F1-model_v4 | Putative dihydrodipicolinate synthase | 0.9834 | 190 | 295 |
GO:0005829
GO:0008840 |
| AF-L1P4I3-F1-model_v4 | 4-hydroxy-tetrahydrodipicolinate synthase (HTPA synthase) (EC 4.3.3.7) | 0.983 | 6 | 291 |
GO:0005829
GO:0008840 GO:0009089 GO:0019877 |
| AF-E4M8I6-F1-model_v4 | 4-hydroxy-tetrahydrodipicolinate synthase (HTPA synthase) (EC 4.3.3.7) | 0.9816 | 4 | 295 |
GO:0005829
GO:0008840 GO:0009089 GO:0019877 |
| AF-A0A0R2QQJ4-F1-model_v4 | 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) | 0.9793 | 51 | 291 |
GO:0005829
GO:0008840 GO:0009089 GO:0019877 |