F267169

General Info

Members Datasets Scaffolds Average Seq Length
175 93 350 295

Family's Representative Sequence

Representative Sequence 3300049666|Ga0501228_001142|Ga0501228_001142_599_1525
Length 308
Sequence METKLPFRGWGYKMSLREKLRGTGVAIITPFKRDQSVDFDALGKLINHIIENGIQYIVSLGTTGEPPVLSKEEKLEVLSFTYAVAAGKVPVVVGISGNNTEALVDEIDSFPLEKAVAVLVASPYYNRPSQEGIFQHYKVVGEASPKPVIVYNVPGRTGSNITAATTVRLAKEIENIAGIKEASGNMVQCMHILRDRPGDFLVVSGDDHITLPLIACGMDGVISVAANCFAKDFCAMVNAALNNNYEKAALLQYKLLEGFDLLFAENNPAGVKAFLKEMGMIENILRLPLVPLSDSIMQQVKKYYPTLK

Samples

Sample ID Description Type Environment
1 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
23 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
24 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
25 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
29 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
33 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
34 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
35 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
50 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
51 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
52 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
53 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
54 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
55 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
56 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
57 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
58 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
59 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
60 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
61 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
62 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
63 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
64 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
65 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
66 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
67 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
68 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
69 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
72 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
73 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
74 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
75 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
76 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
77 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
78 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
79 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
80 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
81 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
82 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
83 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
84 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
85 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
86 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
87 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
88 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
89 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
90 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
91 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
92 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 98.29
Stem 0
Stem Tuber 0
Unclassified 14.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501228_001142 3300049666 Bacteria 1877
2 Ga0070658_10035506 3300005327 Bacteria 4016
3 Ga0070658_10059802 3300005327 Bacteria 3103
4 Ga0070666_10045559 3300005335 Bacteria 2940
5 Ga0070680_100028845 3300005336 Bacteria 4453
6 Ga0070680_100030798 3300005336 Unclassified 4310
7 Ga0070680_100077707 3300005336 Bacteria 2734
8 Ga0070682_100000031 3300005337 Bacteria 156874
9 Ga0070660_100035879 3300005339 Bacteria 3754
10 Ga0070660_100315698 3300005339 Unclassified 1283
11 Ga0070659_100141472 3300005366 Bacteria 1959
12 Ga0070667_100048248 3300005367 Bacteria 3584
13 Ga0070663_100015838 3300005455 Bacteria 4878
14 Ga0070681_10029338 3300005458 Bacteria 5524
15 Ga0070681_10132041 3300005458 Bacteria 2429
16 Ga0070681_10447613 3300005458 Bacteria 1203
17 Ga0070679_100000517 3300005530 Bacteria 32752
18 Ga0070679_100235938 3300005530 Bacteria 1788
19 Ga0070679_100470953 3300005530 Bacteria 1200
20 Ga0070679_100491263 3300005530 Bacteria 1172
21 Ga0068853_100011899 3300005539 Bacteria 7077
22 Ga0068855_100004342 3300005563 Bacteria 17337
23 Ga0068855_100013894 3300005563 Bacteria 9710
24 Ga0068855_100269251 3300005563 Bacteria 1895
25 Ga0068855_100379237 3300005563 Bacteria 1553
26 Ga0068857_100077127 3300005577 Bacteria 2973
27 Ga0068857_100122149 3300005577 Bacteria 2346
28 Ga0068856_100007328 3300005614 Bacteria 10768
29 Ga0068856_100105576 3300005614 Bacteria 2811
30 Ga0068856_100133107 3300005614 Bacteria 2491
31 Ga0068852_100017930 3300005616 Bacteria 5567
32 Ga0068852_100142204 3300005616 Unclassified 2222
33 Ga0068859_100321198 3300005617 Bacteria 1642
34 Ga0068861_100437148 3300005719 Unclassified 1169
35 Ga0068860_100081456 3300005843 Unclassified 3078
36 Ga0097620_100321191 3300006931 Bacteria 1642
37 Ga0105240_10186428 3300009093 Unclassified 2443
38 Ga0105241_10024819 3300009174 Bacteria 4454
39 Ga0105239_10160340 3300010375 Bacteria 2513
40 Ga0157373_10001300 3300013100 Bacteria 19057
41 Ga0157373_10022053 3300013100 Bacteria 4621
42 Ga0157373_10060696 3300013100 Bacteria 2678
43 Ga0157373_10190116 3300013100 Unclassified 1447
44 Ga0157371_10001322 3300013102 Bacteria 26019
45 Ga0157371_10002423 3300013102 Bacteria 17819
46 Ga0157371_10005106 3300013102 Bacteria 11198
47 Ga0157371_10006032 3300013102 Bacteria 10088
48 Ga0157371_10100876 3300013102 Bacteria 2048
49 Ga0157371_10254056 3300013102 Bacteria 1266
50 Ga0157370_10000994 3300013104 Bacteria 35770
51 Ga0157370_10037598 3300013104 Bacteria 4691
52 Ga0157370_10240158 3300013104 Bacteria 1676
53 Ga0157369_10065389 3300013105 Bacteria 3913
54 Ga0157374_10123811 3300013296 Bacteria 2497
55 Ga0157374_10194160 3300013296 Bacteria 1986
56 Ga0163162_10419181 3300013306 Bacteria 1471
57 Ga0157372_10003873 3300013307 Bacteria 16080
58 Ga0157372_10031100 3300013307 Bacteria 5844
59 Ga0157372_10032879 3300013307 Bacteria 5692
60 Ga0157372_10039878 3300013307 Bacteria 5185
61 Ga0157372_10114815 3300013307 Bacteria 3087
62 Ga0157372_10532285 3300013307 Bacteria 1370
63 Ga0157375_10205124 3300013308 Bacteria 2128
64 Ga0157380_10139619 3300014326 Bacteria 2080
65 Ga0157379_10526706 3300014968 Bacteria 1097
66 Ga0157376_10226696 3300014969 Unclassified 1734
67 Ga0207705_10044123 3300025909 Bacteria 3204
68 Ga0207705_10054291 3300025909 Bacteria 2888
69 Ga0207707_10020054 3300025912 Bacteria 5833
70 Ga0207707_10392868 3300025912 Bacteria 1191
71 Ga0207707_10493729 3300025912 Bacteria 1045
72 Ga0207695_10019935 3300025913 Bacteria 7701
73 Ga0207660_10087103 3300025917 Bacteria 2307
74 Ga0207660_10099496 3300025917 Unclassified 2170
75 Ga0207657_10010980 3300025919 Bacteria 9002
76 Ga0207652_10000101 3300025921 Bacteria 93033
77 Ga0207652_10000616 3300025921 Bacteria 35409
78 Ga0207652_10148453 3300025921 Bacteria 2099
79 Ga0207652_10200813 3300025921 Bacteria 1794
80 Ga0207652_10389791 3300025921 Unclassified 1257
81 Ga0207659_10188037 3300025926 Unclassified 1641
82 Ga0207690_10010867 3300025932 Bacteria 5424
83 Ga0207690_10012101 3300025932 Bacteria 5160
84 Ga0207690_10192829 3300025932 Bacteria 1542
85 Ga0207686_10118822 3300025934 Bacteria 1796
86 Ga0207667_10001154 3300025949 Bacteria 33200
87 Ga0207667_10065194 3300025949 Bacteria 3800
88 Ga0207667_10070779 3300025949 Bacteria 3629
89 Ga0207667_10158318 3300025949 Bacteria 2330
90 Ga0207667_10252275 3300025949 Bacteria 1805
91 Ga0207667_10270720 3300025949 Bacteria 1736
92 Ga0207702_10030862 3300026078 Bacteria 4465
93 Ga0207702_10140907 3300026078 Bacteria 2182
94 Ga0207648_10268643 3300026089 Bacteria 1523
95 Ga0207674_10044639 3300026116 Bacteria 4565
96 Ga0207674_10093958 3300026116 Bacteria 2986
97 Ga0268264_10072782 3300028381 Unclassified 2915
98 Ga0265323_10000876 3300028653 Bacteria 15945
99 Ga0265327_10038825 3300031251 Bacteria 2593
100 Ga0265316_10002088 3300031344 Bacteria 21010
101 Ga0265316_10005269 3300031344 Bacteria 12620
102 Ga0265342_10097817 3300031712 Bacteria 1676
103 Ga0307413_10278323 3300031824 Bacteria 1257
104 Ga0395899_0000159 3300037312 Bacteria 102831
105 Ga0395899_0000526 3300037312 Bacteria 42013
106 Ga0395899_0026332 3300037312 Bacteria 4388
107 Ga0395899_0203114 3300037312 Bacteria 1380
108 Ga0395900_0004043 3300037418 Bacteria 15651
109 Ga0395900_0012551 3300037418 Bacteria 8668
110 Ga0395900_0071618 3300037418 Bacteria 3563
111 Ga0395900_0091777 3300037418 Bacteria 3120
112 Ga0395900_0149634 3300037418 Bacteria 2385
113 Ga0395900_0224403 3300037418 Bacteria 1892
114 Ga0395898_0002043 3300037466 Bacteria 25263
115 Ga0395898_0017368 3300037466 Bacteria 7350
116 Ga0395898_0031136 3300037466 Bacteria 5334
117 Ga0395898_0046996 3300037466 Bacteria 4238
118 Ga0395905_0401154 3300037471 Bacteria 1266
119 Ga0395901_0065186 3300038443 Bacteria 3792
120 Ga0395901_0067947 3300038443 Bacteria 3713
121 Ga0395901_0095322 3300038443 Bacteria 3118
122 Ga0395901_0116866 3300038443 Bacteria 2802
123 Ga0400483_051348 3300039062 Bacteria 1089
124 Ga0436365_0040113 3300039437 Bacteria 10715
125 Ga0451855_1103441 3300041511 Bacteria 1099
126 Ga0451577_0004410 3300042876 Bacteria 14879
127 Ga0451577_0012182 3300042876 Bacteria 8085
128 Ga0451577_0025161 3300042876 Bacteria 5404
129 Ga0451577_0064416 3300042876 Bacteria 3269
130 Ga0451577_0378026 3300042876 Bacteria 1285
131 Ga0453683_0196274 3300044673 Bacteria 1281
132 Ga0453684_0000091 3300044712 Bacteria 387720
133 Ga0453684_0002151 3300044712 Bacteria 49340
134 Ga0453684_0003829 3300044712 Bacteria 33184
135 Ga0453684_0011862 3300044712 Bacteria 14515
136 Ga0453684_0024319 3300044712 Bacteria 8859
137 Ga0453684_0043653 3300044712 Bacteria 6021
138 Ga0453684_0368531 3300044712 Bacteria 1615
139 Ga0453684_0719165 3300044712 Bacteria 1083
140 Ga0453684_0765574 3300044712 Bacteria 1044
141 Ga0451576_0047697 3300045051 Bacteria 4502
142 Ga0451576_0068425 3300045051 Bacteria 3695
143 Ga0451576_0346787 3300045051 Bacteria 1555
144 Ga0451576_0395938 3300045051 Bacteria 1448
145 Ga0451576_0468992 3300045051 Bacteria 1322
146 Ga0495672_0113019 3300047320 Bacteria 1455
147 Ga0501032_0193746 3300049569 Bacteria 1328
148 Ga0501034_0020116 3300049571 Bacteria 6814
149 Ga0501034_0109647 3300049571 Bacteria 2751
150 Ga0501036_0099696 3300049572 Bacteria 2457
151 Ga0501047_0028213 3300049581 Bacteria 5410
152 Ga0501198_002343 3300049649 Unclassified 2546
153 Ga0501201_006552 3300049651 Unclassified 1104
154 Ga0501202_005634 3300049652 Unclassified 2219
155 Ga0501206_005227 3300049653 Unclassified 1669
156 Ga0501207_006638 3300049654 Unclassified 1631
157 Ga0501217_005600 3300049661 Unclassified 2632
158 Ga0501222_002801 3300049662 Unclassified 2414
159 Ga0501223_029221 3300049663 Unclassified 1072
160 Ga0501224_002745 3300049664 Bacteria 2425
161 Ga0501233_005012 3300049668 Bacteria 2450
162 Ga0501235_001146 3300049669 Bacteria 5566
163 Ga0501235_034311 3300049669 Bacteria 1151
164 Ga0501240_013287 3300049673 Unclassified 1140
165 Ga0501242_003265 3300049674 Bacteria 1748
166 Ga0501243_004750 3300049675 Bacteria 2042
167 Ga0501252_005495 3300049682 Unclassified 1380
168 Ga0501259_004748 3300049688 Bacteria 2155
169 Ga0501221_002427 3300049704 Bacteria 3071
170 Ga0501225_0025603 3300049705 Bacteria 1622
171 Ga0501234_003409 3300049707 Bacteria 2499
172 Ga0501245_009593 3300049708 Unclassified 1391
173 Ga0501232_008519 3300049757 Unclassified 1111
174 Ga0501035_0505022 3300049822 Bacteria 995
175 Ga0501212_005910 3300049851 Unclassified 1635
176 Ga0501228_001142
177 Ga0070658_10035506
178 Ga0070658_10059802
179 Ga0070666_10045559
180 Ga0070680_100028845
181 Ga0070680_100030798
182 Ga0070680_100077707
183 Ga0070682_100000031
184 Ga0070660_100035879
185 Ga0070660_100315698
186 Ga0070659_100141472
187 Ga0070667_100048248
188 Ga0070663_100015838
189 Ga0070681_10029338
190 Ga0070681_10132041
191 Ga0070681_10447613
192 Ga0070679_100000517
193 Ga0070679_100235938
194 Ga0070679_100470953
195 Ga0070679_100491263
196 Ga0068853_100011899
197 Ga0068855_100004342
198 Ga0068855_100013894
199 Ga0068855_100269251
200 Ga0068855_100379237
201 Ga0068857_100077127
202 Ga0068857_100122149
203 Ga0068856_100007328
204 Ga0068856_100105576
205 Ga0068856_100133107
206 Ga0068852_100017930
207 Ga0068852_100142204
208 Ga0068859_100321198
209 Ga0068861_100437148
210 Ga0068860_100081456
211 Ga0097620_100321191
212 Ga0105240_10186428
213 Ga0105241_10024819
214 Ga0105239_10160340
215 Ga0157373_10001300
216 Ga0157373_10022053
217 Ga0157373_10060696
218 Ga0157373_10190116
219 Ga0157371_10001322
220 Ga0157371_10002423
221 Ga0157371_10005106
222 Ga0157371_10006032
223 Ga0157371_10100876
224 Ga0157371_10254056
225 Ga0157370_10000994
226 Ga0157370_10037598
227 Ga0157370_10240158
228 Ga0157369_10065389
229 Ga0157374_10123811
230 Ga0157374_10194160
231 Ga0163162_10419181
232 Ga0157372_10003873
233 Ga0157372_10031100
234 Ga0157372_10032879
235 Ga0157372_10039878
236 Ga0157372_10114815
237 Ga0157372_10532285
238 Ga0157375_10205124
239 Ga0157380_10139619
240 Ga0157379_10526706
241 Ga0157376_10226696
242 Ga0207705_10044123
243 Ga0207705_10054291
244 Ga0207707_10020054
245 Ga0207707_10392868
246 Ga0207707_10493729
247 Ga0207695_10019935
248 Ga0207660_10087103
249 Ga0207660_10099496
250 Ga0207657_10010980
251 Ga0207652_10000101
252 Ga0207652_10000616
253 Ga0207652_10148453
254 Ga0207652_10200813
255 Ga0207652_10389791
256 Ga0207659_10188037
257 Ga0207690_10010867
258 Ga0207690_10012101
259 Ga0207690_10192829
260 Ga0207686_10118822
261 Ga0207667_10001154
262 Ga0207667_10065194
263 Ga0207667_10070779
264 Ga0207667_10158318
265 Ga0207667_10252275
266 Ga0207667_10270720
267 Ga0207702_10030862
268 Ga0207702_10140907
269 Ga0207648_10268643
270 Ga0207674_10044639
271 Ga0207674_10093958
272 Ga0268264_10072782
273 Ga0265323_10000876
274 Ga0265327_10038825
275 Ga0265316_10002088
276 Ga0265316_10005269
277 Ga0265342_10097817
278 Ga0307413_10278323
279 Ga0395899_0000159
280 Ga0395899_0000526
281 Ga0395899_0026332
282 Ga0395899_0203114
283 Ga0395900_0004043
284 Ga0395900_0012551
285 Ga0395900_0071618
286 Ga0395900_0091777
287 Ga0395900_0149634
288 Ga0395900_0224403
289 Ga0395898_0002043
290 Ga0395898_0017368
291 Ga0395898_0031136
292 Ga0395898_0046996
293 Ga0395905_0401154
294 Ga0395901_0065186
295 Ga0395901_0067947
296 Ga0395901_0095322
297 Ga0395901_0116866
298 Ga0400483_051348
299 Ga0436365_0040113
300 Ga0451855_1103441
301 Ga0451577_0004410
302 Ga0451577_0012182
303 Ga0451577_0025161
304 Ga0451577_0064416
305 Ga0451577_0378026
306 Ga0453683_0196274
307 Ga0453684_0000091
308 Ga0453684_0002151
309 Ga0453684_0003829
310 Ga0453684_0011862
311 Ga0453684_0024319
312 Ga0453684_0043653
313 Ga0453684_0368531
314 Ga0453684_0719165
315 Ga0453684_0765574
316 Ga0451576_0047697
317 Ga0451576_0068425
318 Ga0451576_0346787
319 Ga0451576_0395938
320 Ga0451576_0468992
321 Ga0495672_0113019
322 Ga0501032_0193746
323 Ga0501034_0020116
324 Ga0501034_0109647
325 Ga0501036_0099696
326 Ga0501047_0028213
327 Ga0501198_002343
328 Ga0501201_006552
329 Ga0501202_005634
330 Ga0501206_005227
331 Ga0501207_006638
332 Ga0501217_005600
333 Ga0501222_002801
334 Ga0501223_029221
335 Ga0501224_002745
336 Ga0501233_005012
337 Ga0501235_001146
338 Ga0501235_034311
339 Ga0501240_013287
340 Ga0501242_003265
341 Ga0501243_004750
342 Ga0501252_005495
343 Ga0501259_004748
344 Ga0501221_002427
345 Ga0501225_0025603
346 Ga0501234_003409
347 Ga0501245_009593
348 Ga0501232_008519
349 Ga0501035_0505022
350 Ga0501212_005910

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00701

DHDPS

Dihydrodipicolinate synthetase family

19

306

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6mqh-assembly1.cif.gz_A crystal structure of 4-hydroxy-tetrahydrodipicolinate synthase (htpa synthase) from burkholderia mallei 0.9674 7 295
3noe-assembly1.cif.gz_A crystal structure of dihydrodipicolinate synthase from pseudomonas aeruginosa 0.9672 7 292
3flu-assembly1.cif.gz_B crystal structure of dihydrodipicolinate synthase from the pathogen neisseria meningitidis 0.9664 7 293
6p90-assembly1.cif.gz_B crystal structure of padhdps2-h56q mutant 0.9662 7 292
3pud-assembly1.cif.gz_A crystal structure of dhydrodipicolinate synthase from acinetobacter baumannii at 2.8a resolution 0.9654 7 292
ID Description Score Start End Superfamily
3pb2D00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9617 4 295 3.20.20.70
6nvaA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9602 5 295 3.20.20.70
2yxgD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.959 8 295 3.20.20.70
2rfgB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9576 7 297 3.20.20.70
3a5fA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9575 8 295 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7W1PWR2-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) 0.9834 5 230 GO:0005829
GO:0008840
GO:0009089
GO:0019877
AF-A3XRN1-F1-model_v4 Putative dihydrodipicolinate synthase 0.9834 190 295 GO:0005829
GO:0008840
AF-L1P4I3-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (HTPA synthase) (EC 4.3.3.7) 0.983 6 291 GO:0005829
GO:0008840
GO:0009089
GO:0019877
AF-E4M8I6-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (HTPA synthase) (EC 4.3.3.7) 0.9816 4 295 GO:0005829
GO:0008840
GO:0009089
GO:0019877
AF-A0A0R2QQJ4-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) 0.9793 51 291 GO:0005829
GO:0008840
GO:0009089
GO:0019877

Map