F266621

General Info

Members Datasets Scaffolds Average Seq Length
175 129 350 228

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_10183738|Ga0307410_101837382
Length 248
Sequence MTTTTMPDASTADVSPVDGRTRLGTILVTGGASGLGAATVDAVRTAGGSPLVLDLAAPTDGVPYEQVDLSDAVAAERAVSAIVAANGGRLDGVFTAAGIDSCGPLDQVPMADWERVIKVNLLGTAAVIRAALPHLKRSQGRVVTCASTLGIKAVGDATAYCASKFGVVGFTRALAAETAGEVGVTLLIPGGMHTPFFDGRTEQYKPPPDAKLNQPADVAAAVVFALSQPPGCEVRELVVCASTEASWP

Samples

Sample ID Description Type Environment
1 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
16 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
34 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
37 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
38 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
53 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
57 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
58 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
59 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
60 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
61 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
62 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
63 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
64 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
65 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
66 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
67 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
68 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
69 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
70 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
71 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
72 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
73 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
74 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
75 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
76 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
77 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
78 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
79 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
80 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
81 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
82 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
83 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
84 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
85 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
99 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
100 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
101 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
102 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
103 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
104 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
105 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
106 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
107 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
108 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
109 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
111 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
112 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
113 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
114 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
115 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
116 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
117 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
118 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
119 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
120 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
121 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
122 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
123 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
124 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
125 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
126 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
127 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
128 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
129 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96
Metatranscriptomes 0
Isolates 4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.43
Nodule 0
Rhizoplane 0
Rhizosphere 91.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307410_10183738 3300031852 Bacteria 1585
2 JGI25407J50210_10019297 3300003373 Bacteria 1772
3 Ga0070683_100577956 3300005329 Bacteria 1075
4 Ga0070682_100209587 3300005337 Bacteria 1380
5 Ga0068868_100099051 3300005338 Bacteria 2357
6 Ga0070668_100030609 3300005347 Bacteria 4092
7 Ga0070669_100067947 3300005353 Bacteria 2630
8 Ga0070674_100394056 3300005356 Bacteria 1130
9 Ga0070714_100171269 3300005435 Archaea 1970
10 Ga0070710_10058535 3300005437 Bacteria 2186
11 Ga0070700_100105322 3300005441 Bacteria 1865
12 Ga0070662_100020177 3300005457 Bacteria 4535
13 Ga0068867_100163345 3300005459 Bacteria 1758
14 Ga0070665_100070700 3300005548 Bacteria 3497
15 Ga0068866_10007965 3300005718 Bacteria 4449
16 Ga0068861_100502040 3300005719 Bacteria 1097
17 Ga0081455_10027770 3300005937 Bacteria 5182
18 Ga0081455_10472481 3300005937 Bacteria 850
19 Ga0081538_10000771 3300005981 Bacteria 35031
20 Ga0081539_10000967 3300005985 Bacteria 53682
21 Ga0081539_10001575 3300005985 Bacteria 37703
22 Ga0081539_10126587 3300005985 Bacteria 1261
23 Ga0070717_10634073 3300006028 Bacteria 970
24 Ga0075365_10147967 3300006038 Bacteria 1633
25 Ga0075364_10018528 3300006051 Bacteria 4359
26 Ga0075432_10004460 3300006058 Bacteria 4773
27 Ga0075430_100014754 3300006846 Bacteria 6653
28 Ga0075433_10003109 3300006852 Bacteria 12777
29 Ga0075434_100006432 3300006871 Bacteria 10763
30 Ga0075436_100017432 3300006914 Bacteria 4917
31 Ga0075435_100005207 3300007076 Bacteria 9047
32 Ga0111539_10088701 3300009094 Bacteria 3634
33 Ga0105245_10243939 3300009098 Bacteria 1743
34 Ga0105243_10008497 3300009148 Bacteria 7879
35 Ga0105239_10105658 3300010375 Bacteria 3118
36 Ga0157313_1004819 3300012503 Bacteria 947
37 Ga0157371_10200760 3300013102 Bacteria 1429
38 Ga0163162_10338439 3300013306 Bacteria 1637
39 Ga0163161_10062403 3300017792 Bacteria 2715
40 Ga0213876_10074267 3300021384 Bacteria 1796
41 Ga0209051_1004180 3300025303 Bacteria 9020
42 Ga0207692_10039327 3300025898 Bacteria 2326
43 Ga0207681_10171363 3300025923 Bacteria 1645
44 Ga0207664_10124935 3300025929 Bacteria 2159
45 Ga0207686_10086284 3300025934 Bacteria 2061
46 Ga0207704_10236242 3300025938 Bacteria 1363
47 Ga0207661_10161377 3300025944 Bacteria 1945
48 Ga0207712_10183679 3300025961 Bacteria 1645
49 Ga0207668_10004542 3300025972 Bacteria 8165
50 Ga0207668_10085615 3300025972 Bacteria 2301
51 Ga0207678_10474563 3300026067 Bacteria 1089
52 Ga0207708_10139232 3300026075 Bacteria 1902
53 Ga0207648_10280387 3300026089 Bacteria 1490
54 Ga0207675_100452936 3300026118 Bacteria 1272
55 Ga0207683_10313233 3300026121 Bacteria 1437
56 Ga0207428_10007395 3300027907 Bacteria 10017
57 Ga0268266_10160259 3300028379 Bacteria 2035
58 Ga0268265_10016955 3300028380 Bacteria 5015
59 Ga0268264_10472848 3300028381 Bacteria 1218
60 Ga0307408_100024720 3300031548 Bacteria 4106
61 Ga0307405_10005784 3300031731 Bacteria 6013
62 Ga0307405_10057146 3300031731 Bacteria 2450
63 Ga0307413_10003674 3300031824 Bacteria 6517
64 Ga0307413_10014563 3300031824 Bacteria 3999
65 Ga0307413_10207010 3300031824 Bacteria 1421
66 Ga0307410_10000152 3300031852 Bacteria 24788
67 Ga0307410_10007153 3300031852 Bacteria 6087
68 Ga0307410_10127230 3300031852 Bacteria 1867
69 Ga0307410_10146769 3300031852 Bacteria 1751
70 Ga0326468_10001920 3300031889 Bacteria 1746
71 Ga0307406_10003179 3300031901 Bacteria 8938
72 Ga0307406_10003901 3300031901 Bacteria 8114
73 Ga0307406_10136725 3300031901 Bacteria 1728
74 Ga0307407_10029512 3300031903 Bacteria 2947
75 Ga0307407_10044869 3300031903 Bacteria 2494
76 Ga0307407_10204082 3300031903 Bacteria 1326
77 Ga0307412_10024149 3300031911 Bacteria 3750
78 Ga0307412_10072140 3300031911 Bacteria 2359
79 Ga0307409_100000001 3300031995 Bacteria 93927
80 Ga0307409_100215365 3300031995 Bacteria 1729
81 Ga0307409_100661576 3300031995 Bacteria 1040
82 Ga0307409_100904785 3300031995 Bacteria 896
83 Ga0307416_100000115 3300032002 Bacteria 48098
84 Ga0307416_100011132 3300032002 Bacteria 5983
85 Ga0307416_100289572 3300032002 Bacteria 1620
86 Ga0307416_101353880 3300032002 Bacteria 818
87 Ga0307414_10316502 3300032004 Bacteria 1326
88 Ga0307414_10413430 3300032004 Bacteria 1175
89 Ga0307411_10019986 3300032005 Bacteria 3883
90 Ga0307411_10225767 3300032005 Bacteria 1456
91 Ga0307415_100002604 3300032126 Bacteria 9006
92 Ga0307415_100081425 3300032126 Bacteria 2313
93 Ga0307415_100225857 3300032126 Bacteria 1504
94 Ga0307510_10388816 3300033180 Bacteria 839
95 Ga0373951_0000083 3300035091 Bacteria 37209
96 Ga0436364_0056819 3300037853 Bacteria 19807
97 Ga0436365_0762232 3300039437 Bacteria 2261
98 Ga0436361_0232612 3300039447 Bacteria 19974
99 Ga0436361_0650584 3300039447 Bacteria 17691
100 Ga0439463_097755 3300042016 Bacteria 757
101 Ga0439460_0029159 3300042461 Bacteria 1561
102 Ga0466972_0011076 3300044658 Bacteria 4527
103 Ga0466972_0013129 3300044658 Bacteria 4162
104 Ga0466972_0042278 3300044658 Bacteria 2216
105 Ga0466972_0046602 3300044658 Bacteria 2098
106 Ga0466965_0018714 3300044683 Bacteria 3323
107 Ga0466965_0432420 3300044683 Bacteria 731
108 Ga0466966_0049304 3300044684 Bacteria 2682
109 Ga0466966_0128899 3300044684 Bacteria 1550
110 Ga0466963_0017232 3300044694 Bacteria 4501
111 Ga0466963_0023581 3300044694 Bacteria 3910
112 Ga0466963_0493204 3300044694 Bacteria 865
113 Ga0466964_0065746 3300044706 Bacteria 1520
114 Ga0466971_0018918 3300044719 Bacteria 3055
115 Ga0466971_0185254 3300044719 Bacteria 979
116 Ga0466968_0022457 3300044735 Bacteria 2565
117 Ga0466968_0027577 3300044735 Bacteria 2338
118 Ga0466957_0110565 3300044842 Bacteria 1742
119 Ga0466957_0382977 3300044842 Bacteria 959
120 Ga0466960_0000550 3300044901 Bacteria 12898
121 Ga0466960_0066032 3300044901 Bacteria 1788
122 Ga0466959_0019012 3300045049 Bacteria 5049
123 Ga0466959_0181639 3300045049 Bacteria 1471
124 Ga0466958_0036737 3300045836 Bacteria 2933
125 Ga0466967_0000459 3300045976 Bacteria 19611
126 Ga0466967_0001475 3300045976 Bacteria 13710
127 Ga0466967_0053687 3300045976 Bacteria 3543
128 Ga0466967_0247571 3300045976 Bacteria 1702
129 Ga0466967_0252893 3300045976 Bacteria 1684
130 Ga0466967_0277234 3300045976 Bacteria 1608
131 Ga0466967_0322008 3300045976 Bacteria 1491
132 Ga0501032_0023287 3300049569 Bacteria 4283
133 Ga0501033_0204210 3300049570 Bacteria 1411
134 Ga0501034_0003137 3300049571 Bacteria 19031
135 Ga0501036_0027544 3300049572 Bacteria 4802
136 Ga0501037_0013104 3300049573 Bacteria 6113
137 Ga0501038_0004455 3300049574 Bacteria 13019
138 Ga0501039_0001237 3300049575 Bacteria 18717
139 Ga0501040_0039475 3300049576 Bacteria 3210
140 Ga0501041_0019251 3300049577 Bacteria 4074
141 Ga0501042_0049103 3300049578 Bacteria 3010
142 Ga0501043_0003679 3300049579 Bacteria 12592
143 Ga0501067_0224888 3300049583 Bacteria 1045
144 Ga0501070_0006642 3300049586 Bacteria 9847
145 Ga0501071_0005506 3300049587 Bacteria 8150
146 Ga0501072_0025557 3300049588 Bacteria 4600
147 Ga0501072_0081698 3300049588 Bacteria 2562
148 Ga0501073_0048051 3300049589 Bacteria 2997
149 Ga0501074_0125376 3300049590 Bacteria 1837
150 Ga0501077_0443579 3300049593 Bacteria 831
151 Ga0501216_015504 3300049660 Bacteria 1286
152 Ga0501217_078935 3300049661 Bacteria 908
153 Ga0501079_0017172 3300049741 Bacteria 5526
154 Ga0501080_0454967 3300049742 Bacteria 1147
155 Ga0501044_0025520 3300049823 Bacteria 6265
156 Ga0501045_0006772 3300049824 Bacteria 7937
157 nmdc:mga00v17_30831_c1 3300050491 Bacteria 3157
158 nmdc:mga0yw44_254520_c1 3300050492 Bacteria 1169
159 nmdc:mga0qj67_10971_c1 3300050509 Bacteria 6782
160 nmdc:mga08y16_5145_c1 3300050511 Bacteria 13670
161 nmdc:mga0n895_109405_c1 3300050512 Bacteria 2779
162 nmdc:mga0rr50_17532_c1 3300050513 Bacteria 4784
163 nmdc:mga08x19_5440_c2 3300050514 Bacteria 6522
164 nmdc:mga0a205_35768_c1 3300050515 Bacteria 4770
165 nmdc:mga0sz30_42391_c1 3300050516 Bacteria 1915
166 Ga0495655_0092429 3300053083 Bacteria 883
167 Ga0501084_0126192 3300054114 Bacteria 2153
168 Ga0530510_0192443 3300061734 Bacteria 1514
169 2552107834 2551306166 Bacteria 9731570
170 2753266029 2751185782 Bacteria 11227053
171 2866614144 2866612099 Bacteria 7543886
172 2902800704 2902799365 Bacteria 5419524
173 2902839309 2902837492 Bacteria 6697721
174 2928146527 2928142448 Bacteria 5288925
175 2929214121 2929212328 Bacteria 7708288
176 Ga0307410_10183738
177 JGI25407J50210_10019297
178 Ga0070683_100577956
179 Ga0070682_100209587
180 Ga0068868_100099051
181 Ga0070668_100030609
182 Ga0070669_100067947
183 Ga0070674_100394056
184 Ga0070714_100171269
185 Ga0070710_10058535
186 Ga0070700_100105322
187 Ga0070662_100020177
188 Ga0068867_100163345
189 Ga0070665_100070700
190 Ga0068866_10007965
191 Ga0068861_100502040
192 Ga0081455_10027770
193 Ga0081455_10472481
194 Ga0081538_10000771
195 Ga0081539_10000967
196 Ga0081539_10001575
197 Ga0081539_10126587
198 Ga0070717_10634073
199 Ga0075365_10147967
200 Ga0075364_10018528
201 Ga0075432_10004460
202 Ga0075430_100014754
203 Ga0075433_10003109
204 Ga0075434_100006432
205 Ga0075436_100017432
206 Ga0075435_100005207
207 Ga0111539_10088701
208 Ga0105245_10243939
209 Ga0105243_10008497
210 Ga0105239_10105658
211 Ga0157313_1004819
212 Ga0157371_10200760
213 Ga0163162_10338439
214 Ga0163161_10062403
215 Ga0213876_10074267
216 Ga0209051_1004180
217 Ga0207692_10039327
218 Ga0207681_10171363
219 Ga0207664_10124935
220 Ga0207686_10086284
221 Ga0207704_10236242
222 Ga0207661_10161377
223 Ga0207712_10183679
224 Ga0207668_10004542
225 Ga0207668_10085615
226 Ga0207678_10474563
227 Ga0207708_10139232
228 Ga0207648_10280387
229 Ga0207675_100452936
230 Ga0207683_10313233
231 Ga0207428_10007395
232 Ga0268266_10160259
233 Ga0268265_10016955
234 Ga0268264_10472848
235 Ga0307408_100024720
236 Ga0307405_10005784
237 Ga0307405_10057146
238 Ga0307413_10003674
239 Ga0307413_10014563
240 Ga0307413_10207010
241 Ga0307410_10000152
242 Ga0307410_10007153
243 Ga0307410_10127230
244 Ga0307410_10146769
245 Ga0326468_10001920
246 Ga0307406_10003179
247 Ga0307406_10003901
248 Ga0307406_10136725
249 Ga0307407_10029512
250 Ga0307407_10044869
251 Ga0307407_10204082
252 Ga0307412_10024149
253 Ga0307412_10072140
254 Ga0307409_100000001
255 Ga0307409_100215365
256 Ga0307409_100661576
257 Ga0307409_100904785
258 Ga0307416_100000115
259 Ga0307416_100011132
260 Ga0307416_100289572
261 Ga0307416_101353880
262 Ga0307414_10316502
263 Ga0307414_10413430
264 Ga0307411_10019986
265 Ga0307411_10225767
266 Ga0307415_100002604
267 Ga0307415_100081425
268 Ga0307415_100225857
269 Ga0307510_10388816
270 Ga0373951_0000083
271 Ga0436364_0056819
272 Ga0436365_0762232
273 Ga0436361_0232612
274 Ga0436361_0650584
275 Ga0439463_097755
276 Ga0439460_0029159
277 Ga0466972_0011076
278 Ga0466972_0013129
279 Ga0466972_0042278
280 Ga0466972_0046602
281 Ga0466965_0018714
282 Ga0466965_0432420
283 Ga0466966_0049304
284 Ga0466966_0128899
285 Ga0466963_0017232
286 Ga0466963_0023581
287 Ga0466963_0493204
288 Ga0466964_0065746
289 Ga0466971_0018918
290 Ga0466971_0185254
291 Ga0466968_0022457
292 Ga0466968_0027577
293 Ga0466957_0110565
294 Ga0466957_0382977
295 Ga0466960_0000550
296 Ga0466960_0066032
297 Ga0466959_0019012
298 Ga0466959_0181639
299 Ga0466958_0036737
300 Ga0466967_0000459
301 Ga0466967_0001475
302 Ga0466967_0053687
303 Ga0466967_0247571
304 Ga0466967_0252893
305 Ga0466967_0277234
306 Ga0466967_0322008
307 Ga0501032_0023287
308 Ga0501033_0204210
309 Ga0501034_0003137
310 Ga0501036_0027544
311 Ga0501037_0013104
312 Ga0501038_0004455
313 Ga0501039_0001237
314 Ga0501040_0039475
315 Ga0501041_0019251
316 Ga0501042_0049103
317 Ga0501043_0003679
318 Ga0501067_0224888
319 Ga0501070_0006642
320 Ga0501071_0005506
321 Ga0501072_0025557
322 Ga0501072_0081698
323 Ga0501073_0048051
324 Ga0501074_0125376
325 Ga0501077_0443579
326 Ga0501216_015504
327 Ga0501217_078935
328 Ga0501079_0017172
329 Ga0501080_0454967
330 Ga0501044_0025520
331 Ga0501045_0006772
332 nmdc:mga00v17_30831_c1
333 nmdc:mga0yw44_254520_c1
334 nmdc:mga0qj67_10971_c1
335 nmdc:mga08y16_5145_c1
336 nmdc:mga0n895_109405_c1
337 nmdc:mga0rr50_17532_c1
338 nmdc:mga08x19_5440_c2
339 nmdc:mga0a205_35768_c1
340 nmdc:mga0sz30_42391_c1
341 Ga0495655_0092429
342 Ga0501084_0126192
343 Ga0530510_0192443
344 2552107834
345 2753266029
346 2866614144
347 2902800704
348 2902839309
349 2928146527
350 2929214121

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

24

205

0.93

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

30

232

0.86

PF08659

KR

KR domain

24

186

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jap-assembly1.cif.gz_C clavulanic acid dehydrogenase: structural and biochemical analysis of the final step in the biosynthesis of the beta-lactamase inhibitor clavulanic acid 0.8685 17 227
3p19-assembly1.cif.gz_A improved nadph-dependent blue fluorescent protein 0.8619 22 227
1ae1-assembly1.cif.gz_B tropinone reductase-i complex with nadp 0.8604 21 220
6qck-assembly1.cif.gz_A 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with fb262 0.8596 20 220
5hs6-assembly1.cif.gz_A human 17beta-hydroxysteroid dehydrogenase type 14 in complex with estrone 0.8589 20 221
ID Description Score Start End Superfamily
af_Q54N15_5_159_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8803 66 159 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8779 21 181 3.40.50.720
af_Q54PT0_1_244_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8573 22 226 3.40.50.720
af_P0AFP4_15_258_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8569 22 217 3.40.50.720
af_O15744_2_259_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8539 23 228 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2W6DD07-F1-model_v4 Short-chain dehydrogenase 0.9609 72 217 GO:0016491
AF-A0A378U7I7-F1-model_v4 Oxidoreductase, short chain dehydrogenase/reductase (EC 1.-.-.-) 0.9387 63 230 GO:0016491
AF-A0A2R4FWT2-F1-model_v4 Short-chain dehydrogenase 0.9375 24 230 GO:0016616
GO:0030497
AF-A0A318NS20-F1-model_v4 Short-chain dehydrogenase 0.9358 22 230 GO:0016616
AF-A0A1C6SPB1-F1-model_v4 Short-chain dehydrogenase 0.9302 21 230 GO:0016616

Map