F266547

General Info

Members Datasets Scaffolds Average Seq Length
175 113 350 367

Family's Representative Sequence

Representative Sequence 3300028653|Ga0265323_10015937|Ga0265323_100159373
Length 393
Sequence MGYDARSLSTSASDTMSAMIVGVPKEIKEHEYRAGILPVGVEELSRSGHRILVQKGLGLGSGIRDSDYERSGAVVVEHAAEIFSMADLVVKVKEPQPSEIALLRDGQVVFTYFHFAASEALTRGVLASGATAIAYETLQDRRGNLCLLTPMSEVAGRMSIQQGAKFLERPQEGRGILLGGVPGVEPAHITVLGGXXXXSQAAKIAAGFGASVAVLDSNLDRLRYLDDIMPHNVTTLFSDRHTILDQLAKADLVVGAVLIRGARTPRLVRKEDLKLMKPGAVVVDVAVDQGGCFETTHPTTHSEPTYLVDDIVHYAVANMPGAVGRTSTYALCNATLPYVLHLASCGLGEAVKRNPELVSAINVHRGQVTNLAVAETFSLPYVPFPPEAAPGSN

Samples

Sample ID Description Type Environment
1 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
6 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
41 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
42 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
58 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
59 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
60 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
61 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
62 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
64 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
65 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
66 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
67 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
68 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
69 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
70 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
71 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
72 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
73 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
74 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
75 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
76 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
77 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
78 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
79 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
80 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
81 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
82 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
83 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
84 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
85 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
86 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
87 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
88 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
89 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
90 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
91 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
92 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
93 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
95 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
96 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
97 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
98 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
99 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
100 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
101 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
102 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
103 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
104 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
105 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
106 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
107 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
108 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
109 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
110 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
111 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
112 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
113 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96
Metatranscriptomes 0.57
Isolates 3.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.14
Nodule 1.71
Rhizoplane 2.29
Rhizosphere 90.29
Stem 0
Stem Tuber 0
Unclassified 2.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265323_10015937 3300028653 Bacteria 2944
2 rootH2_10052900 3300003320 Bacteria 4188
3 rootH2_10081755 3300003320 Bacteria 1854
4 rootH2_10111043 3300003320 Bacteria 8690
5 rootH2_10149608 3300003320 Bacteria 4443
6 Ga0070714_100204533 3300005435 Bacteria 1807
7 Ga0070713_100155048 3300005436 Bacteria 2041
8 Ga0070711_100000763 3300005439 Bacteria 16750
9 Ga0070694_100001036 3300005444 Bacteria 15846
10 Ga0070708_100119723 3300005445 Bacteria 2427
11 Ga0070706_100061745 3300005467 Bacteria 3460
12 Ga0070707_100103711 3300005468 Bacteria 2756
13 Ga0070698_100002188 3300005471 Bacteria 21703
14 Ga0070699_100027021 3300005518 Bacteria 4950
15 Ga0070699_100051698 3300005518 Bacteria 3558
16 Ga0070699_100332997 3300005518 Bacteria 1366
17 Ga0068853_100003721 3300005539 Bacteria 11713
18 Ga0068853_100128504 3300005539 Bacteria 2266
19 Ga0070672_100016802 3300005543 Bacteria 5249
20 Ga0070695_100000766 3300005545 Bacteria 17268
21 Ga0070695_100209767 3300005545 Bacteria 1397
22 Ga0070696_100005782 3300005546 Bacteria 8257
23 Ga0070696_100064412 3300005546 Bacteria 2568
24 Ga0068855_100005934 3300005563 Bacteria 14893
25 Ga0068855_100094578 3300005563 Bacteria 3445
26 Ga0068857_100004388 3300005577 Bacteria 11925
27 Ga0068856_100043586 3300005614 Bacteria 4414
28 Ga0068859_100035911 3300005617 Bacteria 4973
29 Ga0070716_100063889 3300006173 Bacteria 2139
30 Ga0075428_100011777 3300006844 Bacteria 9735
31 Ga0075428_100105231 3300006844 Bacteria 3077
32 Ga0075430_100036569 3300006846 Bacteria 4163
33 Ga0075431_100011331 3300006847 Bacteria 8983
34 Ga0075433_10001175 3300006852 Bacteria 19043
35 Ga0075433_10001760 3300006852 Bacteria 16197
36 Ga0075433_10109528 3300006852 Bacteria 2450
37 Ga0075433_10248705 3300006852 Bacteria 1578
38 Ga0075434_100007143 3300006871 Bacteria 10320
39 Ga0075434_100030425 3300006871 Bacteria 5316
40 Ga0075434_100174681 3300006871 Bacteria 2168
41 Ga0075429_100001499 3300006880 Bacteria 19226
42 Ga0075429_100082060 3300006880 Bacteria 2810
43 Ga0068865_100024140 3300006881 Bacteria 3987
44 Ga0075436_100019215 3300006914 Bacteria 4681
45 Ga0075436_100048595 3300006914 Bacteria 2927
46 Ga0097620_100035911 3300006931 Bacteria 4973
47 Ga0075435_100031073 3300007076 Bacteria 4205
48 Ga0075435_100174905 3300007076 Bacteria 1812
49 Ga0099794_10000062 3300007265 Bacteria 41045
50 Ga0111539_10025438 3300009094 Bacteria 7258
51 Ga0114129_10211494 3300009147 Bacteria 2622
52 Ga0105243_10030111 3300009148 Bacteria 4177
53 Ga0105242_10007673 3300009176 Bacteria 8304
54 Ga0105237_10000013 3300009545 Bacteria 297699
55 Ga0105237_10035063 3300009545 Bacteria 5078
56 Ga0105237_10429883 3300009545 Bacteria 1326
57 Ga0105238_10091653 3300009551 Unclassified 3026
58 Ga0105239_10024228 3300010375 Bacteria 6684
59 Ga0105239_10449079 3300010375 Bacteria 1462
60 Ga0157378_10096870 3300013297 Bacteria 2688
61 Ga0163161_10000901 3300017792 Bacteria 23077
62 Ga0213873_10012172 3300021358 Bacteria 1860
63 Ga0207653_10000170 3300025885 Bacteria 45893
64 Ga0207653_10014680 3300025885 Bacteria 2458
65 Ga0207699_10001317 3300025906 Bacteria 11801
66 Ga0207684_10190194 3300025910 Bacteria 1770
67 Ga0207671_10000024 3300025914 Bacteria 274628
68 Ga0207671_10032499 3300025914 Bacteria 3884
69 Ga0207663_10000529 3300025916 Bacteria 16741
70 Ga0207646_10040525 3300025922 Bacteria 4188
71 Ga0207646_10110743 3300025922 Bacteria 2464
72 Ga0207646_10165708 3300025922 Bacteria 1995
73 Ga0207694_10081176 3300025924 Unclassified 2546
74 Ga0207700_10095607 3300025928 Bacteria 2357
75 Ga0207686_10185812 3300025934 Bacteria 1477
76 Ga0207665_10041704 3300025939 Bacteria 3066
77 Ga0207691_10002541 3300025940 Bacteria 17822
78 Ga0207667_10002832 3300025949 Bacteria 21530
79 Ga0207667_10021142 3300025949 Bacteria 7216
80 Ga0207639_10104124 3300026041 Bacteria 2300
81 Ga0207702_10233511 3300026078 Bacteria 1720
82 Ga0207674_10004711 3300026116 Bacteria 16356
83 Ga0207428_10030867 3300027907 Bacteria 4427
84 Ga0265326_10001965 3300028558 Bacteria 7039
85 Ga0265318_10048573 3300028577 Unclassified 1598
86 Ga0265323_10029108 3300028653 Bacteria 2068
87 Ga0265323_10049272 3300028653 Bacteria 1499
88 Ga0265338_10021032 3300028800 Bacteria 6826
89 Ga0265324_10000100 3300029957 Bacteria 67937
90 Ga0265760_10004140 3300031090 Bacteria 4178
91 Ga0265330_10000343 3300031235 Bacteria 33202
92 Ga0265330_10004361 3300031235 Bacteria 7193
93 Ga0265330_10012498 3300031235 Bacteria 3971
94 Ga0265325_10001142 3300031241 Bacteria 19073
95 Ga0265329_10037842 3300031242 Bacteria 1553
96 Ga0265340_10000140 3300031247 Bacteria 36366
97 Ga0265340_10000508 3300031247 Bacteria 21378
98 Ga0265340_10010139 3300031247 Bacteria 5048
99 Ga0265339_10000018 3300031249 Bacteria 181364
100 Ga0265327_10006780 3300031251 Bacteria 9038
101 Ga0265316_10000422 3300031344 Bacteria 48284
102 Ga0265316_10001265 3300031344 Bacteria 27129
103 Ga0265316_10006865 3300031344 Bacteria 10808
104 Ga0265316_10017107 3300031344 Bacteria 6275
105 Ga0265316_10019976 3300031344 Bacteria 5714
106 Ga0265316_10071052 3300031344 Bacteria 2684
107 Ga0265314_10000007 3300031711 Bacteria 491737
108 Ga0265314_10035977 3300031711 Bacteria 3603
109 Ga0265314_10144111 3300031711 Unclassified 1469
110 Ga0265342_10000762 3300031712 Bacteria 32881
111 Ga0265342_10000913 3300031712 Bacteria 29328
112 Ga0265342_10008326 3300031712 Bacteria 7456
113 Ga0265342_10010413 3300031712 Bacteria 6451
114 Ga0265342_10038778 3300031712 Bacteria 2900
115 Ga0265342_10047964 3300031712 Bacteria 2562
116 Ga0316576_10057222 3300031727 Bacteria 2849
117 Ga0316576_10115017 3300031727 Bacteria 2018
118 Ga0316582_0048168 3300036647 Bacteria 2694
119 Ga0316584_0060713 3300036712 Bacteria 2832
120 Ga0395900_0101921 3300037418 Bacteria 2949
121 Ga0395898_0115191 3300037466 Bacteria 2575
122 Ga0436361_0538593 3300039447 Bacteria 2489
123 Ga0436362_1102916 3300039453 Bacteria 3106
124 Ga0451849_0349684 3300041505 Bacteria 4403
125 Ga0451853_0659125 3300041512 Bacteria 1160
126 Ga0451853_0835239 3300041512 Bacteria 20682
127 Ga0451577_0000010 3300042876 Bacteria 616686
128 Ga0451577_0061837 3300042876 Bacteria 3339
129 Ga0451577_0206611 3300042876 Bacteria 1773
130 Ga0453683_0072704 3300044673 Bacteria 2152
131 Ga0453683_0172453 3300044673 Bacteria 1370
132 Ga0453684_0000130 3300044712 Bacteria 331761
133 Ga0451576_0000957 3300045051 Bacteria 54079
134 Ga0451576_0016840 3300045051 Bacteria 8058
135 Ga0451576_0030755 3300045051 Bacteria 5732
136 Ga0451576_0495324 3300045051 Bacteria 1284
137 Ga0495603_0002732 3300046455 Bacteria 10404
138 Ga0495585_0113799 3300046492 Bacteria 1437
139 Ga0495608_0034455 3300046511 Bacteria 3417
140 Ga0495676_0147602 3300047321 Bacteria 1678
141 Ga0496101_0118651 3300048904 Bacteria 1998
142 Ga0496106_0003306 3300048909 Bacteria 12023
143 Ga0496107_0003777 3300048910 Bacteria 10172
144 Ga0496113_0227499 3300048916 Bacteria 1487
145 Ga0501034_0005884 3300049571 Bacteria 13321
146 Ga0501034_0070059 3300049571 Bacteria 3518
147 Ga0501034_0392315 3300049571 Bacteria 1312
148 Ga0501067_0013001 3300049583 Bacteria 4609
149 Ga0501068_0026212 3300049584 Bacteria 3434
150 Ga0501079_0053040 3300049741 Bacteria 3129
151 Ga0501081_0081322 3300049743 Bacteria 2269
152 nmdc:mga0k408_202091_c1 3300050493 Bacteria 1186
153 nmdc:mga09592_31281_c1 3300050508 Bacteria 4434
154 nmdc:mga09592_467385_c1 3300050508 Bacteria 1088
155 nmdc:mga06r32_12683_c1 3300050510 Bacteria 7617
156 nmdc:mga06r32_369869_c1 3300050510 Bacteria 1417
157 nmdc:mga08y16_9017_c1 3300050511 Bacteria 10474
158 nmdc:mga0n895_222160_c1 3300050512 Bacteria 1918
159 nmdc:mga0n895_2262_c1 3300050512 Bacteria 14919
160 nmdc:mga0n895_2537_c1 3300050512 Bacteria 14302
161 nmdc:mga0n895_777_c1 3300050512 Bacteria 22690
162 nmdc:mga0rr50_175525_c1 3300050513 Bacteria 1749
163 nmdc:mga0a205_5005_c1 3300050515 Bacteria 9385
164 nmdc:mga0a205_55174_c2 3300050515 Bacteria 2105
165 nmdc:mga0a205_582_c1 3300050515 Bacteria 28885
166 Ga0495601_0003056 3300053077 Bacteria 9541
167 Ga0495619_0019231 3300053085 Bacteria 4340
168 Ga0495619_0024508 3300053085 Bacteria 3870
169 Ga0500641_0000458 3300053096 Bacteria 14817
170 2687237342 2684623219 Bacteria 8442773
171 2889418145 2889415604 Bacteria 8048700
172 2920111354 2920107658 Bacteria 10042636
173 2935769993 2935769743 Bacteria 7878163
174 2935785765 2935785616 Bacteria 7962367
175 2935794307 2935793552 Bacteria 8012592
176 Ga0265323_10015937
177 rootH2_10052900
178 rootH2_10081755
179 rootH2_10111043
180 rootH2_10149608
181 Ga0070714_100204533
182 Ga0070713_100155048
183 Ga0070711_100000763
184 Ga0070694_100001036
185 Ga0070708_100119723
186 Ga0070706_100061745
187 Ga0070707_100103711
188 Ga0070698_100002188
189 Ga0070699_100027021
190 Ga0070699_100051698
191 Ga0070699_100332997
192 Ga0068853_100003721
193 Ga0068853_100128504
194 Ga0070672_100016802
195 Ga0070695_100000766
196 Ga0070695_100209767
197 Ga0070696_100005782
198 Ga0070696_100064412
199 Ga0068855_100005934
200 Ga0068855_100094578
201 Ga0068857_100004388
202 Ga0068856_100043586
203 Ga0068859_100035911
204 Ga0070716_100063889
205 Ga0075428_100011777
206 Ga0075428_100105231
207 Ga0075430_100036569
208 Ga0075431_100011331
209 Ga0075433_10001175
210 Ga0075433_10001760
211 Ga0075433_10109528
212 Ga0075433_10248705
213 Ga0075434_100007143
214 Ga0075434_100030425
215 Ga0075434_100174681
216 Ga0075429_100001499
217 Ga0075429_100082060
218 Ga0068865_100024140
219 Ga0075436_100019215
220 Ga0075436_100048595
221 Ga0097620_100035911
222 Ga0075435_100031073
223 Ga0075435_100174905
224 Ga0099794_10000062
225 Ga0111539_10025438
226 Ga0114129_10211494
227 Ga0105243_10030111
228 Ga0105242_10007673
229 Ga0105237_10000013
230 Ga0105237_10035063
231 Ga0105237_10429883
232 Ga0105238_10091653
233 Ga0105239_10024228
234 Ga0105239_10449079
235 Ga0157378_10096870
236 Ga0163161_10000901
237 Ga0213873_10012172
238 Ga0207653_10000170
239 Ga0207653_10014680
240 Ga0207699_10001317
241 Ga0207684_10190194
242 Ga0207671_10000024
243 Ga0207671_10032499
244 Ga0207663_10000529
245 Ga0207646_10040525
246 Ga0207646_10110743
247 Ga0207646_10165708
248 Ga0207694_10081176
249 Ga0207700_10095607
250 Ga0207686_10185812
251 Ga0207665_10041704
252 Ga0207691_10002541
253 Ga0207667_10002832
254 Ga0207667_10021142
255 Ga0207639_10104124
256 Ga0207702_10233511
257 Ga0207674_10004711
258 Ga0207428_10030867
259 Ga0265326_10001965
260 Ga0265318_10048573
261 Ga0265323_10029108
262 Ga0265323_10049272
263 Ga0265338_10021032
264 Ga0265324_10000100
265 Ga0265760_10004140
266 Ga0265330_10000343
267 Ga0265330_10004361
268 Ga0265330_10012498
269 Ga0265325_10001142
270 Ga0265329_10037842
271 Ga0265340_10000140
272 Ga0265340_10000508
273 Ga0265340_10010139
274 Ga0265339_10000018
275 Ga0265327_10006780
276 Ga0265316_10000422
277 Ga0265316_10001265
278 Ga0265316_10006865
279 Ga0265316_10017107
280 Ga0265316_10019976
281 Ga0265316_10071052
282 Ga0265314_10000007
283 Ga0265314_10035977
284 Ga0265314_10144111
285 Ga0265342_10000762
286 Ga0265342_10000913
287 Ga0265342_10008326
288 Ga0265342_10010413
289 Ga0265342_10038778
290 Ga0265342_10047964
291 Ga0316576_10057222
292 Ga0316576_10115017
293 Ga0316582_0048168
294 Ga0316584_0060713
295 Ga0395900_0101921
296 Ga0395898_0115191
297 Ga0436361_0538593
298 Ga0436362_1102916
299 Ga0451849_0349684
300 Ga0451853_0659125
301 Ga0451853_0835239
302 Ga0451577_0000010
303 Ga0451577_0061837
304 Ga0451577_0206611
305 Ga0453683_0072704
306 Ga0453683_0172453
307 Ga0453684_0000130
308 Ga0451576_0000957
309 Ga0451576_0016840
310 Ga0451576_0030755
311 Ga0451576_0495324
312 Ga0495603_0002732
313 Ga0495585_0113799
314 Ga0495608_0034455
315 Ga0495676_0147602
316 Ga0496101_0118651
317 Ga0496106_0003306
318 Ga0496107_0003777
319 Ga0496113_0227499
320 Ga0501034_0005884
321 Ga0501034_0070059
322 Ga0501034_0392315
323 Ga0501067_0013001
324 Ga0501068_0026212
325 Ga0501079_0053040
326 Ga0501081_0081322
327 nmdc:mga0k408_202091_c1
328 nmdc:mga09592_31281_c1
329 nmdc:mga09592_467385_c1
330 nmdc:mga06r32_12683_c1
331 nmdc:mga06r32_369869_c1
332 nmdc:mga08y16_9017_c1
333 nmdc:mga0n895_222160_c1
334 nmdc:mga0n895_2262_c1
335 nmdc:mga0n895_2537_c1
336 nmdc:mga0n895_777_c1
337 nmdc:mga0rr50_175525_c1
338 nmdc:mga0a205_5005_c1
339 nmdc:mga0a205_55174_c2
340 nmdc:mga0a205_582_c1
341 Ga0495601_0003056
342 Ga0495619_0019231
343 Ga0495619_0024508
344 Ga0500641_0000458
345 2687237342
346 2889418145
347 2920111354
348 2935769993
349 2935785765
350 2935794307

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01262

AlaDh_PNT_C

Alanine dehydrogenase/PNT, C-terminal domain

159

371

0.99

PF05222

AlaDh_PNT_N

Alanine dehydrogenase/PNT, N-terminal domain

22

155

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vhw-assembly1.cif.gz_F crystal structure of holo l-alanine dehydrogenase from mycobacterium tuberculosis in the open and closed conformation 0.9888 1 364
2vhv-assembly1.cif.gz_A crystal structure of the d270a mutant of l-alanine dehydrogenase from mycobacterium tuberculosis in complex with nadh. 0.9879 1 364
2vhw-assembly1.cif.gz_F crystal structure of holo l-alanine dehydrogenase from mycobacterium tuberculosis in the open and closed conformation 0.9755 1 364
2vhv-assembly1.cif.gz_A crystal structure of the d270a mutant of l-alanine dehydrogenase from mycobacterium tuberculosis in complex with nadh. 0.9746 1 364
2vhx-assembly1.cif.gz_A crystal structure of the ternary complex of l-alanine dehydrogenase from mycobacterium tuberculosis with nad+ and pyruvate 0.9507 1 364
ID Description Score Start End Superfamily
af_P9WQB1_2_113_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9964 3 113 3.40.50.720
af_Q2FXL7_2_109_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.991 3 109 3.40.50.720
af_Q2FYJ2_1_126_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9863 1 127 3.40.50.720
2vhxC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9847 130 305 3.40.50.720
2vhxC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.979 130 305 3.40.50.720
ID Description Score Start End GO Terms
AF-W1WT97-F1-model_v4 Alanine dehydrogenase 1.002 1 95 GO:0000286
GO:0005886
GO:0006524
AF-A0A7W0ZIX3-F1-model_v4 Alanine dehydrogenase 1.002 1 85 GO:0000286
GO:0005886
GO:0006524
AF-A0A3C0ADQ4-F1-model_v4 Alanine dehydrogenase 1.001 155 279 GO:0000286
GO:0005886
GO:0006524
AF-A0A7C8DU34-F1-model_v4 Alanine dehydrogenase 1.001 1 108 GO:0000286
GO:0005886
GO:0006524
AF-A0A7X6TDV8-F1-model_v4 Alanine dehydrogenase 1.001 1 94 GO:0000286
GO:0005886
GO:0006524

Map