F266542

General Info

Members Datasets Scaffolds Average Seq Length
175 111 350 242

Family's Representative Sequence

Representative Sequence 3300028556|Ga0265337_1056516|Ga0265337_10565162
Length 262
Sequence MEGGTPDSQPSTLNFQPITKMAGHSKWAKVKHFKGAIDAKRGKIFSKLGREITIAAKIGGGDPGMNPRLRMVLLKCRTANMPKDNIERAIKKGTGGGEGTNYEDLTYEIYGPNGVALLVEVSTDNRNRTASDIRSLVTKSGGSIATPGSVSRLFQRKGQIIVSREAAEEDPLMELALEAGAEDFRAEPLGYEIITEPAKFETVHRQVEAKNIKCAAAEITSLPVMTAPLAGTAVAAVNQLIEALEEHDDVKEVFSNAEFPET

Samples

Sample ID Description Type Environment
1 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
51 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
52 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
53 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
54 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
55 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
56 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
57 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
58 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
59 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
60 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
61 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
62 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
63 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
64 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
65 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
66 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
67 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
68 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
69 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
70 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
71 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
72 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
73 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
74 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
78 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
79 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
80 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
81 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
82 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
83 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
84 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
85 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
86 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
87 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
88 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
89 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
90 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
91 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
92 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
93 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
94 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
95 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
96 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
97 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
98 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
99 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
100 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
101 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
102 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
103 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
104 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
105 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
106 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
107 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
108 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
109 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
110 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
111 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.57
Rhizosphere 98.29
Stem 0
Stem Tuber 0
Unclassified 14.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265337_1056516 3300028556 Bacteria 1094
2 rootH1_10045067 3300003323 Bacteria 1454
3 Ga0070683_100071396 3300005329 Bacteria 3240
4 Ga0068868_100081584 3300005338 Bacteria 2593
5 Ga0070689_100069081 3300005340 Unclassified 2756
6 Ga0070689_100544273 3300005340 Bacteria 999
7 Ga0070688_100027911 3300005365 Bacteria 3364
8 Ga0070709_10509584 3300005434 Unclassified 915
9 Ga0070701_10015450 3300005438 Unclassified 3527
10 Ga0070701_10173207 3300005438 Bacteria 1258
11 Ga0070711_100000728 3300005439 Bacteria 17158
12 Ga0070711_100589624 3300005439 Bacteria 926
13 Ga0070705_100521981 3300005440 Bacteria 905
14 Ga0070694_100035630 3300005444 Unclassified 3291
15 Ga0070708_100294633 3300005445 Unclassified 1528
16 Ga0070708_100388671 3300005445 Bacteria 1316
17 Ga0070681_10026799 3300005458 Bacteria 5794
18 Ga0070685_10079908 3300005466 Bacteria 1958
19 Ga0070707_100526344 3300005468 Bacteria 1144
20 Ga0070679_100032668 3300005530 Bacteria 5149
21 Ga0070684_100443539 3300005535 Unclassified 1199
22 Ga0070686_100021166 3300005544 Unclassified 3861
23 Ga0070686_100035093 3300005544 Bacteria 3095
24 Ga0070704_100035867 3300005549 Unclassified 3374
25 Ga0068857_100096184 3300005577 Unclassified 2654
26 Ga0070702_100047819 3300005615 Bacteria 2432
27 Ga0068852_100866810 3300005616 Bacteria 919
28 Ga0068859_100095331 3300005617 Unclassified 3028
29 Ga0068859_100921051 3300005617 Bacteria 958
30 Ga0068863_100057268 3300005841 Bacteria 3688
31 Ga0070717_10304483 3300006028 Bacteria 1417
32 Ga0097621_100026368 3300006237 Bacteria 4558
33 Ga0068871_100004429 3300006358 Bacteria 9768
34 Ga0075428_100261261 3300006844 Bacteria 1864
35 Ga0075434_100200137 3300006871 Bacteria 2017
36 Ga0075429_100562421 3300006880 Bacteria 999
37 Ga0097620_100095337 3300006931 Unclassified 3028
38 Ga0097620_100921172 3300006931 Bacteria 958
39 Ga0099794_10137908 3300007265 Bacteria 1234
40 Ga0105240_10152016 3300009093 Bacteria 2756
41 Ga0105240_10217607 3300009093 Bacteria 2227
42 Ga0111539_10095086 3300009094 Bacteria 3501
43 Ga0111539_10103928 3300009094 Bacteria 3333
44 Ga0111539_10312072 3300009094 Bacteria 1830
45 Ga0114129_10106052 3300009147 Bacteria 3882
46 Ga0105242_10570302 3300009176 Bacteria 1088
47 Ga0105248_10364971 3300009177 Bacteria 1626
48 Ga0105238_10020005 3300009551 Bacteria 6814
49 Ga0105238_10165216 3300009551 Bacteria 2189
50 Ga0157370_10064688 3300013104 Bacteria 3462
51 Ga0157370_10666139 3300013104 Bacteria 951
52 Ga0157374_10787504 3300013296 Bacteria 966
53 Ga0157374_10850501 3300013296 Bacteria 929
54 Ga0157372_10009839 3300013307 Bacteria 10172
55 Ga0157372_11130637 3300013307 Bacteria 906
56 Ga0157376_10052186 3300014969 Unclassified 3399
57 Ga0157376_10171386 3300014969 Bacteria 1977
58 Ga0157376_10824745 3300014969 Bacteria 941
59 Ga0207705_10363178 3300025909 Bacteria 1117
60 Ga0207707_10016532 3300025912 Bacteria 6433
61 Ga0207695_10333140 3300025913 Bacteria 1406
62 Ga0207663_10000834 3300025916 Bacteria 13960
63 Ga0207670_10049298 3300025936 Unclassified 2816
64 Ga0207689_10083241 3300025942 Unclassified 2631
65 Ga0207674_10085906 3300026116 Unclassified 3140
66 Ga0207674_10285241 3300026116 Bacteria 1599
67 Ga0265337_1002338 3300028556 Bacteria 8783
68 Ga0265337_1024888 3300028556 Bacteria 1826
69 Ga0265337_1042251 3300028556 Bacteria 1308
70 Ga0265319_1000003 3300028563 Bacteria 340561
71 Ga0265319_1063469 3300028563 Bacteria 1194
72 Ga0265334_10025392 3300028573 Bacteria 2398
73 Ga0265318_10013623 3300028577 Bacteria 3429
74 Ga0265323_10009162 3300028653 Bacteria 4058
75 Ga0265336_10003510 3300028666 Bacteria 6138
76 Ga0265338_10001568 3300028800 Bacteria 36872
77 Ga0265338_10003767 3300028800 Bacteria 21069
78 Ga0265338_10005636 3300028800 Bacteria 16256
79 Ga0265338_10005872 3300028800 Bacteria 15830
80 Ga0265338_10009147 3300028800 Bacteria 11889
81 Ga0265338_10015850 3300028800 Bacteria 8250
82 Ga0265338_10019773 3300028800 Bacteria 7119
83 Ga0265338_10029083 3300028800 Bacteria 5490
84 Ga0265338_10032201 3300028800 Bacteria 5120
85 Ga0265338_10082814 3300028800 Bacteria 2685
86 Ga0265338_10221387 3300028800 Bacteria 1413
87 Ga0265324_10038568 3300029957 Bacteria 1657
88 Ga0265332_10027452 3300031238 Bacteria 2494
89 Ga0265332_10078650 3300031238 Bacteria 1400
90 Ga0265332_10100333 3300031238 Bacteria 1222
91 Ga0265320_10013126 3300031240 Bacteria 4777
92 Ga0265320_10015345 3300031240 Bacteria 4334
93 Ga0265320_10034476 3300031240 Bacteria 2574
94 Ga0265320_10062141 3300031240 Unclassified 1779
95 Ga0265320_10068690 3300031240 Bacteria 1674
96 Ga0265325_10041977 3300031241 Bacteria 2394
97 Ga0265329_10000651 3300031242 Bacteria 17748
98 Ga0265340_10007476 3300031247 Bacteria 5931
99 Ga0265316_10003242 3300031344 Bacteria 16524
100 Ga0265316_10011857 3300031344 Bacteria 7840
101 Ga0265316_10052940 3300031344 Bacteria 3182
102 Ga0265316_10105751 3300031344 Bacteria 2135
103 Ga0265316_10229684 3300031344 Bacteria 1367
104 Ga0265313_10001728 3300031595 Bacteria 20106
105 Ga0265314_10000435 3300031711 Bacteria 55753
106 Ga0265314_10160093 3300031711 Bacteria 1371
107 Ga0265314_10284455 3300031711 Unclassified 934
108 Ga0265342_10048456 3300031712 Bacteria 2547
109 Ga0265342_10147049 3300031712 Bacteria 1311
110 Ga0265342_10187501 3300031712 Bacteria 1130
111 Ga0373945_0008944 3300035116 Bacteria 3273
112 Ga0373954_0009446 3300035118 Bacteria 4290
113 Ga0373956_0017555 3300035119 Bacteria 3018
114 Ga0373956_0096180 3300035119 Bacteria 1370
115 Ga0373943_0125670 3300035170 Bacteria 1367
116 Ga0373946_0320057 3300035171 Bacteria 770
117 Ga0373935_0001937 3300035692 Bacteria 11638
118 Ga0373927_0006421 3300035695 Bacteria 8013
119 Ga0373947_0062240 3300035725 Bacteria 2270
120 Ga0373937_0125997 3300036401 Bacteria 2389
121 Ga0373937_0505395 3300036401 Bacteria 1148
122 Ga0373925_0009913 3300037068 Bacteria 6920
123 Ga0373925_0097482 3300037068 Unclassified 2255
124 Ga0373925_0127856 3300037068 Bacteria 1979
125 Ga0373925_0329811 3300037068 Bacteria 1236
126 Ga0395900_0058334 3300037418 Bacteria 3974
127 Ga0395905_0219942 3300037471 Unclassified 1777
128 Ga0400487_47351 3300039110 Bacteria 1647
129 Ga0451577_0004707 3300042876 Bacteria 14318
130 Ga0451577_0126128 3300042876 Unclassified 2294
131 Ga0451577_0259146 3300042876 Bacteria 1575
132 Ga0451577_0496506 3300042876 Bacteria 1108
133 Ga0451577_0646477 3300042876 Bacteria 959
134 Ga0453684_0005444 3300044712 Bacteria 25211
135 Ga0453684_0235328 3300044712 Bacteria 2112
136 Ga0453684_0251994 3300044712 Bacteria 2027
137 Ga0451576_0046257 3300045051 Unclassified 4582
138 Ga0451576_0250382 3300045051 Bacteria 1851
139 Ga0451576_0323762 3300045051 Bacteria 1613
140 Ga0495592_0028862 3300046454 Bacteria 4199
141 Ga0495641_0027227 3300046461 Bacteria 2782
142 Ga0495651_0217843 3300046462 Bacteria 1323
143 Ga0495653_0512047 3300046463 Bacteria 747
144 Ga0495580_0062103 3300046472 Bacteria 2622
145 Ga0495664_0095245 3300046477 Bacteria 1792
146 Ga0495618_0001148 3300046514 Bacteria 17948
147 Ga0495628_0112869 3300046516 Bacteria 2089
148 Ga0495630_0033373 3300046517 Bacteria 3838
149 Ga0495630_0093660 3300046517 Unclassified 2271
150 Ga0495666_0028574 3300046526 Bacteria 2744
151 Ga0495652_0048412 3300046529 Bacteria 3643
152 Ga0495640_0055684 3300046533 Bacteria 2705
153 Ga0495640_0062308 3300046533 Unclassified 2530
154 Ga0495586_0001532 3300046535 Bacteria 12749
155 Ga0495586_0012008 3300046535 Bacteria 4601
156 Ga0495645_0129682 3300046543 Bacteria 1768
157 Ga0495622_0193841 3300046557 Unclassified 907
158 Ga0495634_0005467 3300046642 Bacteria 9770
159 Ga0495657_0315861 3300046675 Bacteria 929
160 Ga0495599_0016315 3300046678 Bacteria 4612
161 Ga0495599_0035609 3300046678 Unclassified 3125
162 Ga0495647_0111762 3300046681 Bacteria 1141
163 Ga0495658_0005544 3300046683 Bacteria 6205
164 Ga0495613_0001848 3300046689 Bacteria 16109
165 Ga0495613_0037884 3300046689 Bacteria 3574
166 Ga0495624_0065240 3300046690 Bacteria 2275
167 Ga0495600_0225866 3300046809 Bacteria 1197
168 Ga0495674_0363277 3300047319 Bacteria 1173
169 Ga0495676_0082667 3300047321 Bacteria 2430
170 Ga0495680_0023873 3300047322 Bacteria 5081
171 Ga0496115_0003257 3300048918 Bacteria 11652
172 nmdc:mga09592_580272_c1 3300050508 Bacteria 962
173 nmdc:mga06r32_225421_c1 3300050510 Bacteria 1863
174 nmdc:mga08y16_31443_c1 3300050511 Bacteria 5582
175 nmdc:mga08y16_344963_c1 3300050511 Bacteria 1530
176 Ga0265337_1056516
177 rootH1_10045067
178 Ga0070683_100071396
179 Ga0068868_100081584
180 Ga0070689_100069081
181 Ga0070689_100544273
182 Ga0070688_100027911
183 Ga0070709_10509584
184 Ga0070701_10015450
185 Ga0070701_10173207
186 Ga0070711_100000728
187 Ga0070711_100589624
188 Ga0070705_100521981
189 Ga0070694_100035630
190 Ga0070708_100294633
191 Ga0070708_100388671
192 Ga0070681_10026799
193 Ga0070685_10079908
194 Ga0070707_100526344
195 Ga0070679_100032668
196 Ga0070684_100443539
197 Ga0070686_100021166
198 Ga0070686_100035093
199 Ga0070704_100035867
200 Ga0068857_100096184
201 Ga0070702_100047819
202 Ga0068852_100866810
203 Ga0068859_100095331
204 Ga0068859_100921051
205 Ga0068863_100057268
206 Ga0070717_10304483
207 Ga0097621_100026368
208 Ga0068871_100004429
209 Ga0075428_100261261
210 Ga0075434_100200137
211 Ga0075429_100562421
212 Ga0097620_100095337
213 Ga0097620_100921172
214 Ga0099794_10137908
215 Ga0105240_10152016
216 Ga0105240_10217607
217 Ga0111539_10095086
218 Ga0111539_10103928
219 Ga0111539_10312072
220 Ga0114129_10106052
221 Ga0105242_10570302
222 Ga0105248_10364971
223 Ga0105238_10020005
224 Ga0105238_10165216
225 Ga0157370_10064688
226 Ga0157370_10666139
227 Ga0157374_10787504
228 Ga0157374_10850501
229 Ga0157372_10009839
230 Ga0157372_11130637
231 Ga0157376_10052186
232 Ga0157376_10171386
233 Ga0157376_10824745
234 Ga0207705_10363178
235 Ga0207707_10016532
236 Ga0207695_10333140
237 Ga0207663_10000834
238 Ga0207670_10049298
239 Ga0207689_10083241
240 Ga0207674_10085906
241 Ga0207674_10285241
242 Ga0265337_1002338
243 Ga0265337_1024888
244 Ga0265337_1042251
245 Ga0265319_1000003
246 Ga0265319_1063469
247 Ga0265334_10025392
248 Ga0265318_10013623
249 Ga0265323_10009162
250 Ga0265336_10003510
251 Ga0265338_10001568
252 Ga0265338_10003767
253 Ga0265338_10005636
254 Ga0265338_10005872
255 Ga0265338_10009147
256 Ga0265338_10015850
257 Ga0265338_10019773
258 Ga0265338_10029083
259 Ga0265338_10032201
260 Ga0265338_10082814
261 Ga0265338_10221387
262 Ga0265324_10038568
263 Ga0265332_10027452
264 Ga0265332_10078650
265 Ga0265332_10100333
266 Ga0265320_10013126
267 Ga0265320_10015345
268 Ga0265320_10034476
269 Ga0265320_10062141
270 Ga0265320_10068690
271 Ga0265325_10041977
272 Ga0265329_10000651
273 Ga0265340_10007476
274 Ga0265316_10003242
275 Ga0265316_10011857
276 Ga0265316_10052940
277 Ga0265316_10105751
278 Ga0265316_10229684
279 Ga0265313_10001728
280 Ga0265314_10000435
281 Ga0265314_10160093
282 Ga0265314_10284455
283 Ga0265342_10048456
284 Ga0265342_10147049
285 Ga0265342_10187501
286 Ga0373945_0008944
287 Ga0373954_0009446
288 Ga0373956_0017555
289 Ga0373956_0096180
290 Ga0373943_0125670
291 Ga0373946_0320057
292 Ga0373935_0001937
293 Ga0373927_0006421
294 Ga0373947_0062240
295 Ga0373937_0125997
296 Ga0373937_0505395
297 Ga0373925_0009913
298 Ga0373925_0097482
299 Ga0373925_0127856
300 Ga0373925_0329811
301 Ga0395900_0058334
302 Ga0395905_0219942
303 Ga0400487_47351
304 Ga0451577_0004707
305 Ga0451577_0126128
306 Ga0451577_0259146
307 Ga0451577_0496506
308 Ga0451577_0646477
309 Ga0453684_0005444
310 Ga0453684_0235328
311 Ga0453684_0251994
312 Ga0451576_0046257
313 Ga0451576_0250382
314 Ga0451576_0323762
315 Ga0495592_0028862
316 Ga0495641_0027227
317 Ga0495651_0217843
318 Ga0495653_0512047
319 Ga0495580_0062103
320 Ga0495664_0095245
321 Ga0495618_0001148
322 Ga0495628_0112869
323 Ga0495630_0033373
324 Ga0495630_0093660
325 Ga0495666_0028574
326 Ga0495652_0048412
327 Ga0495640_0055684
328 Ga0495640_0062308
329 Ga0495586_0001532
330 Ga0495586_0012008
331 Ga0495645_0129682
332 Ga0495622_0193841
333 Ga0495634_0005467
334 Ga0495657_0315861
335 Ga0495599_0016315
336 Ga0495599_0035609
337 Ga0495647_0111762
338 Ga0495658_0005544
339 Ga0495613_0001848
340 Ga0495613_0037884
341 Ga0495624_0065240
342 Ga0495600_0225866
343 Ga0495674_0363277
344 Ga0495676_0082667
345 Ga0495680_0023873
346 Ga0496115_0003257
347 nmdc:mga09592_580272_c1
348 nmdc:mga06r32_225421_c1
349 nmdc:mga08y16_31443_c1
350 nmdc:mga08y16_344963_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20772

TACO1_YebC_N

TACO1/YebC protein N-terminal domain

25

96

0.98

PF01709

Transcrip_reg

TACO1/YebC second and third domain

102

257

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1lfp-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein aq1575 from aquifex aeolicus 0.888 17 241
1mw7-assembly1.cif.gz_A x-ray structure of y162_helpy northeast structural genomics consortium target pr6 0.8873 24 238
1kon-assembly1.cif.gz_A crystal structure of e.coli yebc 0.8667 3 240
1mw7-assembly1.cif.gz_A x-ray structure of y162_helpy northeast structural genomics consortium target pr6 0.8649 24 238
1kon-assembly1.cif.gz_A crystal structure of e.coli yebc 0.8385 3 240
ID Description Score Start End Superfamily
1mw7A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9692 27 75 1.10.10.200
1lfpA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9533 83 241 3.30.70.980
af_I1K9D8_53_128_1.10.10.200 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9267 5 78 1.10.10.200
af_Q6F2Z2_64_139_1.10.10.200 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9179 6 78 1.10.10.200
1lfpA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9046 19 78 1.10.10.200
ID Description Score Start End GO Terms
AF-A0A7W1IE32-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9749 50 240 GO:0003677
GO:0005829
GO:0006355
AF-A0A383DIA1-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9721 1 188 GO:0003677
GO:0005829
AF-K1UEW2-F1-model_v4 Protein containing DUF28 0.9628 83 239 GO:0005829
AF-A0A383DIA1-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.962 1 188 GO:0003677
GO:0005829
AF-A0A382WX36-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9586 1 194 GO:0003677
GO:0005829

Map