F266256

General Info

Members Datasets Scaffolds Average Seq Length
175 128 350 144

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10471023|Ga0105247_104710231
Length 174
Sequence MAADHKAVYLRPAMDAKSPAVILRRGSGGLRRQTMMRSLLAVAIGIGLGAVGMAAMQHGAHGTVRTIAERDITEKLDGKDAKVSFVEVSLEPGEANAAHRHPGPVFGYVLEGEFEWAINDEPAKVFKTGDTFYEPAGCLHRVSKSAATKGKTRVLAVVVYPRDAKQLVIPEPVK

Samples

Sample ID Description Type Environment
1 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
4 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
5 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
8 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
11 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
12 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
13 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
14 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
15 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
16 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
17 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
18 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
19 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
20 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
21 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
25 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
26 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
32 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
33 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
34 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
36 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
39 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
40 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
41 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
57 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
58 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
59 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
60 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
61 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
62 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
63 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
64 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
65 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
66 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
67 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
68 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
69 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
70 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
71 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
72 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
73 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
74 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
75 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
76 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
77 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
78 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
79 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
80 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
81 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
82 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
83 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
84 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
85 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
86 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
87 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
88 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
89 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
90 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
91 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
92 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
93 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
94 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
95 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
96 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
97 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
98 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
102 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
103 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
104 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
105 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
107 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
108 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
109 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
110 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
111 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
112 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
113 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
114 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
115 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
116 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
117 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
118 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
125 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
126 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
127 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
128 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.29
Metatranscriptomes 8
Isolates 1.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.14
Nodule 0
Rhizoplane 12
Rhizosphere 76
Stem 0
Stem Tuber 0
Unclassified 10.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105247_10471023 3300009101 Unclassified 910
2 Ga0070658_11798179 3300005327 Bacteria 530
3 Ga0070710_11005092 3300005437 Bacteria 608
4 Ga0070701_11194337 3300005438 Unclassified 539
5 Ga0070711_100313146 3300005439 Bacteria 1252
6 Ga0070681_10787852 3300005458 Bacteria 867
7 Ga0070698_101457583 3300005471 Bacteria 636
8 Ga0070699_100533271 3300005518 Bacteria 1068
9 Ga0070699_101151387 3300005518 Bacteria 711
10 Ga0068855_101160009 3300005563 Bacteria 805
11 Ga0068859_101289087 3300005617 Unclassified 805
12 Ga0068864_100784454 3300005618 Unclassified 935
13 Ga0068860_100096823 3300005843 Bacteria 2813
14 Ga0068862_102040445 3300005844 Unclassified 584
15 Ga0081538_10065124 3300005981 Bacteria 2055
16 Ga0081538_10084598 3300005981 Bacteria 1670
17 Ga0075432_10403463 3300006058 Bacteria 591
18 Ga0075428_100009200 3300006844 Bacteria 10960
19 Ga0075428_101744612 3300006844 Unclassified 649
20 Ga0075430_100010170 3300006846 Bacteria 7966
21 Ga0075431_100103209 3300006847 Bacteria 2943
22 Ga0075431_100722668 3300006847 Bacteria 973
23 Ga0075433_10044524 3300006852 Bacteria 3856
24 Ga0075434_100063617 3300006871 Bacteria 3672
25 Ga0097620_101288981 3300006931 Unclassified 805
26 Ga0075435_100001379 3300007076 Bacteria 15691
27 Ga0114129_10033351 3300009147 Bacteria 7276
28 Ga0114129_10485165 3300009147 Bacteria 1616
29 Ga0114129_10795765 3300009147 Bacteria 1207
30 Ga0114129_11425841 3300009147 Bacteria 854
31 Ga0105243_11140707 3300009148 Unclassified 790
32 Ga0105241_10778868 3300009174 Bacteria 879
33 Ga0105242_11148895 3300009176 Bacteria 793
34 Ga0105249_10558449 3300009553 Unclassified 1196
35 Ga0105249_11802130 3300009553 Unclassified 685
36 Ga0105249_11855798 3300009553 Bacteria 675
37 Ga0157370_10964645 3300013104 Bacteria 773
38 Ga0157369_11417458 3300013105 Bacteria 707
39 Ga0157372_12581446 3300013307 Bacteria 583
40 Ga0163163_10146648 3300014325 Bacteria 2404
41 Ga0163163_11597432 3300014325 Unclassified 713
42 Ga0157379_10503162 3300014968 Bacteria 1123
43 Ga0157376_11544684 3300014969 Bacteria 697
44 Ga0206356_10078868 3300020070 Bacteria 1463
45 Ga0206356_10844664 3300020070 Bacteria 658
46 Ga0206355_1075175 3300020076 Bacteria 690
47 Ga0206351_10008710 3300020077 Bacteria 817
48 Ga0206350_10438161 3300020080 Bacteria 683
49 Ga0206350_10596497 3300020080 Bacteria 1668
50 Ga0213873_10024273 3300021358 Bacteria 1453
51 Ga0213872_10136211 3300021361 Bacteria 1079
52 Ga0213876_10305496 3300021384 Unclassified 846
53 Ga0224712_10021794 3300022467 Bacteria 2198
54 Ga0224712_10384537 3300022467 Bacteria 667
55 Ga0207692_10292721 3300025898 Bacteria 989
56 Ga0207671_10083710 3300025914 Bacteria 2395
57 Ga0207693_10120613 3300025915 Bacteria 2059
58 Ga0207652_10887268 3300025921 Bacteria 788
59 Ga0207694_10540970 3300025924 Bacteria 977
60 Ga0207694_10562575 3300025924 Bacteria 958
61 Ga0207700_10358077 3300025928 Bacteria 1272
62 Ga0207664_10560724 3300025929 Bacteria 1025
63 Ga0207665_10391915 3300025939 Bacteria 1056
64 Ga0207678_10709188 3300026067 Bacteria 886
65 Ga0207708_10895256 3300026075 Unclassified 768
66 Ga0207702_10211341 3300026078 Bacteria 1804
67 Ga0207675_100602537 3300026118 Unclassified 1102
68 Ga0209971_1053391 3300027682 Bacteria 977
69 Ga0268264_10078602 3300028381 Bacteria 2813
70 Ga0373931_1160764 3300035691 Bacteria 528
71 Ga0395905_1027099 3300037471 Bacteria 728
72 Ga0436364_0526125 3300037853 Bacteria 757
73 Ga0436364_1189697 3300037853 Bacteria 556
74 Ga0436365_0505583 3300039437 Bacteria 750
75 Ga0436365_1286214 3300039437 Bacteria 583
76 Ga0436360_0021461 3300039438 Bacteria 840
77 Ga0436360_0113244 3300039438 Bacteria 3160
78 Ga0436360_0155064 3300039438 Bacteria 2108
79 Ga0436360_0257172 3300039438 Bacteria 1493
80 Ga0436360_0894166 3300039438 Bacteria 3146
81 Ga0436360_1032117 3300039438 Bacteria 743
82 Ga0436360_1148927 3300039438 Bacteria 1395
83 Ga0436361_0517053 3300039447 Bacteria 4581
84 Ga0436361_0877696 3300039447 Bacteria 2716
85 Ga0436361_1094811 3300039447 Bacteria 897
86 Ga0436361_1183609 3300039447 Bacteria 979
87 Ga0436363_1080388 3300039450 Bacteria 831
88 Ga0436363_1311805 3300039450 Bacteria 3190
89 Ga0436363_1400491 3300039450 Bacteria 600
90 Ga0436363_1414636 3300039450 Bacteria 1013
91 Ga0436362_0265837 3300039453 Bacteria 1175
92 Ga0436362_0860462 3300039453 Bacteria 994
93 Ga0436362_0953600 3300039453 Bacteria 609
94 Ga0436362_1190331 3300039453 Bacteria 6530
95 Ga0451795_1505972 3300041456 Bacteria 703
96 Ga0451798_0817850 3300041458 Bacteria 576
97 Ga0451802_1220409 3300041460 Bacteria 618
98 Ga0451804_0939622 3300041463 Bacteria 897
99 Ga0451837_0166463 3300041494 Bacteria 502
100 Ga0451845_0558787 3300041501 Bacteria 610
101 Ga0451847_0318548 3300041503 Bacteria 737
102 Ga0451853_1284924 3300041512 Bacteria 630
103 Ga0451853_2763209 3300041512 Bacteria 1050
104 Ga0451853_3470075 3300041512 Bacteria 944
105 Ga0439464_0174404 3300042439 Bacteria 679
106 Ga0466966_0389250 3300044684 Bacteria 838
107 Ga0466968_0091474 3300044735 Bacteria 1349
108 Ga0466968_0165770 3300044735 Bacteria 1022
109 Ga0466957_0739748 3300044842 Bacteria 696
110 Ga0466959_0957212 3300045049 Bacteria 571
111 Ga0466959_1011249 3300045049 Bacteria 554
112 Ga0466959_1126955 3300045049 Bacteria 522
113 Ga0466958_1056598 3300045836 Bacteria 530
114 Ga0495608_0006619 3300046511 Bacteria 8227
115 Ga0495667_0049212 3300046559 Bacteria 2782
116 Ga0495599_0396348 3300046678 Bacteria 823
117 Ga0495604_0267453 3300047317 Bacteria 1159
118 Ga0496100_0913558 3300048903 Bacteria 690
119 Ga0496101_0262750 3300048904 Bacteria 1347
120 Ga0496102_0290872 3300048905 Bacteria 1540
121 Ga0496103_0466168 3300048906 Bacteria 810
122 Ga0496103_0981507 3300048906 Bacteria 527
123 Ga0496104_0715834 3300048907 Bacteria 909
124 Ga0496106_0242662 3300048909 Bacteria 1440
125 Ga0496106_0689466 3300048909 Bacteria 815
126 Ga0496107_0762607 3300048910 Bacteria 710
127 Ga0496109_1250302 3300048912 Bacteria 679
128 Ga0496110_1378053 3300048913 Bacteria 615
129 Ga0496111_0993363 3300048914 Bacteria 602
130 Ga0496112_0254963 3300048915 Bacteria 1705
131 Ga0496113_1323429 3300048916 Bacteria 560
132 Ga0496114_0477079 3300048917 Bacteria 1104
133 Ga0496115_0405959 3300048918 Bacteria 1105
134 Ga0496115_1150552 3300048918 Bacteria 586
135 Ga0496118_0160853 3300048921 Bacteria 1389
136 Ga0496126_0746600 3300048929 Bacteria 756
137 Ga0501033_0319562 3300049570 Bacteria 1091
138 Ga0501034_0385007 3300049571 Bacteria 1327
139 Ga0501034_0387034 3300049571 Bacteria 1323
140 Ga0501036_1611429 3300049572 Bacteria 524
141 Ga0501068_0085600 3300049584 Bacteria 1940
142 Ga0501070_0498368 3300049586 Bacteria 979
143 Ga0501070_0731390 3300049586 Unclassified 781
144 Ga0501072_0219951 3300049588 Bacteria 1514
145 Ga0501077_0246542 3300049593 Bacteria 1136
146 Ga0501035_0123642 3300049822 Bacteria 2260
147 Ga0501035_0494942 3300049822 Bacteria 1007
148 Ga0501044_0111749 3300049823 Bacteria 2739
149 Ga0501044_0624878 3300049823 Bacteria 968
150 Ga0501044_0909134 3300049823 Bacteria 755
151 nmdc:mga04h51_359733_c1 3300050495 Unclassified 603
152 nmdc:mga05p37_360773_c1 3300050507 Bacteria 1708
153 nmdc:mga05p37_3770_c1 3300050507 Bacteria 17744
154 nmdc:mga05p37_626171_c1 3300050507 Bacteria 1210
155 nmdc:mga09592_720590_c1 3300050508 Unclassified 848
156 nmdc:mga0qj67_45105_c1 3300050509 Bacteria 3478
157 nmdc:mga06r32_18037_c1 3300050510 Bacteria 6455
158 nmdc:mga06r32_663289_c1 3300050510 Bacteria 1010
159 nmdc:mga0n895_649810_c1 3300050512 Unclassified 1054
160 nmdc:mga0a205_305765_c1 3300050515 Bacteria 1463
161 Ga0495601_0361199 3300053077 Bacteria 944
162 Ga0495595_0571661 3300053084 Bacteria 578
163 Ga0495619_0887317 3300053085 Bacteria 600
164 Ga0500627_0221979 3300053158 Unclassified 843
165 Ga0587066_137733 3300059490 Bacteria 593
166 Ga0587090_069135 3300059510 Bacteria 686
167 Ga0587069_030840 3300059642 Bacteria 866
168 Ga0587078_028773 3300059646 Bacteria 740
169 Ga0587079_089642 3300059647 Bacteria 717
170 Ga0587071_100618 3300060344 Bacteria 668
171 Ga0466962_0160777 3300061719 Bacteria 1092
172 Ga0530510_0322239 3300061734 Bacteria 1159
173 2673168743 2671180531 Bacteria 9045424
174 2688066713 2687453257 Bacteria 6784659
175 2889416719 2889415604 Bacteria 8048700
176 Ga0105247_10471023
177 Ga0070658_11798179
178 Ga0070710_11005092
179 Ga0070701_11194337
180 Ga0070711_100313146
181 Ga0070681_10787852
182 Ga0070698_101457583
183 Ga0070699_100533271
184 Ga0070699_101151387
185 Ga0068855_101160009
186 Ga0068859_101289087
187 Ga0068864_100784454
188 Ga0068860_100096823
189 Ga0068862_102040445
190 Ga0081538_10065124
191 Ga0081538_10084598
192 Ga0075432_10403463
193 Ga0075428_100009200
194 Ga0075428_101744612
195 Ga0075430_100010170
196 Ga0075431_100103209
197 Ga0075431_100722668
198 Ga0075433_10044524
199 Ga0075434_100063617
200 Ga0097620_101288981
201 Ga0075435_100001379
202 Ga0114129_10033351
203 Ga0114129_10485165
204 Ga0114129_10795765
205 Ga0114129_11425841
206 Ga0105243_11140707
207 Ga0105241_10778868
208 Ga0105242_11148895
209 Ga0105249_10558449
210 Ga0105249_11802130
211 Ga0105249_11855798
212 Ga0157370_10964645
213 Ga0157369_11417458
214 Ga0157372_12581446
215 Ga0163163_10146648
216 Ga0163163_11597432
217 Ga0157379_10503162
218 Ga0157376_11544684
219 Ga0206356_10078868
220 Ga0206356_10844664
221 Ga0206355_1075175
222 Ga0206351_10008710
223 Ga0206350_10438161
224 Ga0206350_10596497
225 Ga0213873_10024273
226 Ga0213872_10136211
227 Ga0213876_10305496
228 Ga0224712_10021794
229 Ga0224712_10384537
230 Ga0207692_10292721
231 Ga0207671_10083710
232 Ga0207693_10120613
233 Ga0207652_10887268
234 Ga0207694_10540970
235 Ga0207694_10562575
236 Ga0207700_10358077
237 Ga0207664_10560724
238 Ga0207665_10391915
239 Ga0207678_10709188
240 Ga0207708_10895256
241 Ga0207702_10211341
242 Ga0207675_100602537
243 Ga0209971_1053391
244 Ga0268264_10078602
245 Ga0373931_1160764
246 Ga0395905_1027099
247 Ga0436364_0526125
248 Ga0436364_1189697
249 Ga0436365_0505583
250 Ga0436365_1286214
251 Ga0436360_0021461
252 Ga0436360_0113244
253 Ga0436360_0155064
254 Ga0436360_0257172
255 Ga0436360_0894166
256 Ga0436360_1032117
257 Ga0436360_1148927
258 Ga0436361_0517053
259 Ga0436361_0877696
260 Ga0436361_1094811
261 Ga0436361_1183609
262 Ga0436363_1080388
263 Ga0436363_1311805
264 Ga0436363_1400491
265 Ga0436363_1414636
266 Ga0436362_0265837
267 Ga0436362_0860462
268 Ga0436362_0953600
269 Ga0436362_1190331
270 Ga0451795_1505972
271 Ga0451798_0817850
272 Ga0451802_1220409
273 Ga0451804_0939622
274 Ga0451837_0166463
275 Ga0451845_0558787
276 Ga0451847_0318548
277 Ga0451853_1284924
278 Ga0451853_2763209
279 Ga0451853_3470075
280 Ga0439464_0174404
281 Ga0466966_0389250
282 Ga0466968_0091474
283 Ga0466968_0165770
284 Ga0466957_0739748
285 Ga0466959_0957212
286 Ga0466959_1011249
287 Ga0466959_1126955
288 Ga0466958_1056598
289 Ga0495608_0006619
290 Ga0495667_0049212
291 Ga0495599_0396348
292 Ga0495604_0267453
293 Ga0496100_0913558
294 Ga0496101_0262750
295 Ga0496102_0290872
296 Ga0496103_0466168
297 Ga0496103_0981507
298 Ga0496104_0715834
299 Ga0496106_0242662
300 Ga0496106_0689466
301 Ga0496107_0762607
302 Ga0496109_1250302
303 Ga0496110_1378053
304 Ga0496111_0993363
305 Ga0496112_0254963
306 Ga0496113_1323429
307 Ga0496114_0477079
308 Ga0496115_0405959
309 Ga0496115_1150552
310 Ga0496118_0160853
311 Ga0496126_0746600
312 Ga0501033_0319562
313 Ga0501034_0385007
314 Ga0501034_0387034
315 Ga0501036_1611429
316 Ga0501068_0085600
317 Ga0501070_0498368
318 Ga0501070_0731390
319 Ga0501072_0219951
320 Ga0501077_0246542
321 Ga0501035_0123642
322 Ga0501035_0494942
323 Ga0501044_0111749
324 Ga0501044_0624878
325 Ga0501044_0909134
326 nmdc:mga04h51_359733_c1
327 nmdc:mga05p37_360773_c1
328 nmdc:mga05p37_3770_c1
329 nmdc:mga05p37_626171_c1
330 nmdc:mga09592_720590_c1
331 nmdc:mga0qj67_45105_c1
332 nmdc:mga06r32_18037_c1
333 nmdc:mga06r32_663289_c1
334 nmdc:mga0n895_649810_c1
335 nmdc:mga0a205_305765_c1
336 Ga0495601_0361199
337 Ga0495595_0571661
338 Ga0495619_0887317
339 Ga0500627_0221979
340 Ga0587066_137733
341 Ga0587090_069135
342 Ga0587069_030840
343 Ga0587078_028773
344 Ga0587079_089642
345 Ga0587071_100618
346 Ga0466962_0160777
347 Ga0530510_0322239
348 2673168743
349 2688066713
350 2889416719

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

86

158

0.86

PF12973

Cupin_7

ChrR Cupin-like domain

75

158

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m9r-assembly1.cif.gz_A crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 with a bound n(delta)-hydroxy-n(omega)-methyl-l-arginine intermediate 0.9113 50 124
6m9s-assembly2.cif.gz_D crystal structure of semet sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 0.9108 50 124
6m9s-assembly2.cif.gz_C crystal structure of semet sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 0.9103 50 124
6m9r-assembly1.cif.gz_B crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 with a bound n(delta)-hydroxy-n(omega)-methyl-l-arginine intermediate 0.9102 50 124
6m9s-assembly1.cif.gz_B crystal structure of semet sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 0.9101 50 124
ID Description Score Start End Superfamily
af_I1L9C7_24_223_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9305 50 123 2.60.120.10
af_P15456_18_284_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.902 50 124 2.60.120.10
af_Q9S772_37_227_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8955 50 127 2.60.120.10
af_C7S8C3_18_207_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8893 50 124 2.60.120.10
af_C6T0Q1_25_220_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8716 50 127 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A517NUW2-F1-model_v4 Isonitrile hydratase (EC 4.2.1.103) 0.9845 28 139 GO:0016209
GO:0016491
GO:0050549
AF-M5U1L2-F1-model_v4 Transcriptional regulator 0.9798 28 137
AF-A0A1P8W8V4-F1-model_v4 Cupin domain protein 0.9796 31 136
AF-A0A517PWX3-F1-model_v4 Cupin domain protein 0.9746 29 139
AF-A0A2A5H0L1-F1-model_v4 Cupin 0.9661 29 138

Map