F266182

General Info

Members Datasets Scaffolds Average Seq Length
175 124 350 328

Family's Representative Sequence

Representative Sequence 3300006881|Ga0068865_100119357|Ga0068865_1001193571
Length 368
Sequence MVTSDLIARARAGDGEAFQELIEPYRRELQVHCYRMLGSLQDAEDVLQESLLAAWQGLGRFEERASIRTWLYRIATNRCLNARRSVRRRPAKEWDIAEYQPPEPTRFGEIVWLEPFPDALLEGVMDAPEGPEARYERAETISLAFVAALQVLPPRQLAVVVLRDVLGFHANEVAEMLDSTIDSINSLLKRARAGLQSRLSAGVDHEPAPAPDSPSEKATVAEFVRAYESGDLDALVALLTDDIFLSMPPFPLEYEGIDVVTRFYERMIGSGRRFDLVPTRANGQPAFGAYLHAPSGVRHGTGLLVLTLAGDRIRSVTRFETGVLARFGLPRSLPSDSRPLADVLKLRCGTRRVSVGGIVIVAWHPPLS

Samples

Sample ID Description Type Environment
1 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
74 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
75 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
76 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
77 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
78 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
85 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
86 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
87 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
88 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
89 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
90 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
91 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
92 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
93 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
94 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
95 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
96 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
97 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
98 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
99 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
100 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
101 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
102 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
103 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
104 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
107 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
109 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
110 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
111 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
112 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
113 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
114 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
115 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
116 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
117 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
118 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
119 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
120 2687453737 Frankia sp. BMG5.36 Isolate Nodule
121 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
122 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
123 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
124 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96
Metatranscriptomes 0
Isolates 4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.71
Nodule 1.71
Rhizoplane 2.29
Rhizosphere 89.14
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068865_100119357 3300006881 Bacteria 1958
2 JGI24752J21851_1003144 3300001976 Bacteria 2178
3 rootH2_10015486 3300003320 Bacteria 3511
4 rootL2_10138377 3300003322 Bacteria 2760
5 rootH1_10070562 3300003323 Bacteria 5698
6 rootH1_10110857 3300003323 Bacteria 3412
7 rootH1_10158745 3300003323 Bacteria 3163
8 Ga0070670_100005252 3300005331 Bacteria 10909
9 Ga0070682_100178031 3300005337 Bacteria 1483
10 Ga0068868_100082604 3300005338 Bacteria 2577
11 Ga0070667_100010544 3300005367 Bacteria 7627
12 Ga0070667_100195569 3300005367 Bacteria 1793
13 Ga0070703_10013717 3300005406 Bacteria 2304
14 Ga0070714_100105189 3300005435 Bacteria 2492
15 Ga0070713_100077526 3300005436 Bacteria 2826
16 Ga0070700_100024344 3300005441 Bacteria 3553
17 Ga0070663_100007261 3300005455 Bacteria 6736
18 Ga0070681_10097891 3300005458 Bacteria 2880
19 Ga0070699_100038367 3300005518 Bacteria 4148
20 Ga0070679_100002712 3300005530 Bacteria 16119
21 Ga0070679_100351654 3300005530 Bacteria 1421
22 Ga0070684_100001696 3300005535 Bacteria 16032
23 Ga0070686_100234478 3300005544 Bacteria 1333
24 Ga0070665_100000454 3300005548 Bacteria 59667
25 Ga0070665_100207194 3300005548 Bacteria 1961
26 Ga0068855_100066147 3300005563 Bacteria 4214
27 Ga0070664_100009698 3300005564 Bacteria 7811
28 Ga0068857_100121352 3300005577 Bacteria 2353
29 Ga0068856_100090500 3300005614 Bacteria 3043
30 Ga0068864_100024995 3300005618 Bacteria 5027
31 Ga0068864_100398728 3300005618 Bacteria 1307
32 Ga0068870_10082032 3300005840 Bacteria 1785
33 Ga0068863_100014163 3300005841 Bacteria 7683
34 Ga0081455_10169119 3300005937 Bacteria 1667
35 Ga0081540_1057257 3300005983 Bacteria 1886
36 Ga0081539_10020328 3300005985 Bacteria 4493
37 Ga0075428_100016247 3300006844 Bacteria 8228
38 Ga0075430_100006514 3300006846 Bacteria 9843
39 Ga0075431_100051340 3300006847 Bacteria 4253
40 Ga0075431_100225488 3300006847 Bacteria 1911
41 Ga0075431_100287853 3300006847 Bacteria 1663
42 Ga0075429_100005979 3300006880 Bacteria 10517
43 Ga0075436_100031227 3300006914 Bacteria 3667
44 Ga0105240_10045415 3300009093 Bacteria 5573
45 Ga0105240_10154244 3300009093 Bacteria 2733
46 Ga0111539_10002203 3300009094 Bacteria 26016
47 Ga0111539_10002909 3300009094 Bacteria 22718
48 Ga0111539_10075755 3300009094 Bacteria 3963
49 Ga0111539_10291046 3300009094 Bacteria 1901
50 Ga0105245_10014007 3300009098 Bacteria 6984
51 Ga0105245_10213251 3300009098 Bacteria 1859
52 Ga0114129_10023802 3300009147 Bacteria 8681
53 Ga0114129_10031108 3300009147 Bacteria 7549
54 Ga0114129_10448133 3300009147 Bacteria 1693
55 Ga0105242_10081148 3300009176 Bacteria 2712
56 Ga0105242_10177037 3300009176 Bacteria 1879
57 Ga0105237_10052903 3300009545 Bacteria 4074
58 Ga0105237_10206800 3300009545 Bacteria 1963
59 Ga0105249_10075807 3300009553 Bacteria 3115
60 Ga0105239_10452125 3300010375 Bacteria 1457
61 Ga0105246_10006074 3300011119 Bacteria 7367
62 Ga0105246_10210855 3300011119 Bacteria 1516
63 Ga0157370_10027465 3300013104 Bacteria 5611
64 Ga0157369_10008645 3300013105 Bacteria 11680
65 Ga0163163_10022414 3300014325 Bacteria 5980
66 Ga0163163_10057560 3300014325 Bacteria 3844
67 Ga0207653_10019642 3300025885 Bacteria 2132
68 Ga0207643_10000948 3300025908 Bacteria 17422
69 Ga0207707_10010127 3300025912 Bacteria 8181
70 Ga0207695_10063430 3300025913 Bacteria 3810
71 Ga0207695_10172199 3300025913 Bacteria 2090
72 Ga0207671_10051042 3300025914 Bacteria 3064
73 Ga0207671_10237169 3300025914 Bacteria 1432
74 Ga0207663_10002715 3300025916 Bacteria 8527
75 Ga0207649_10056321 3300025920 Bacteria 2455
76 Ga0207652_10014181 3300025921 Bacteria 6454
77 Ga0207687_10008342 3300025927 Bacteria 6778
78 Ga0207700_10091943 3300025928 Bacteria 2398
79 Ga0207700_10471345 3300025928 Bacteria 1109
80 Ga0207664_10289241 3300025929 Bacteria 1440
81 Ga0207644_10037363 3300025931 Bacteria 3416
82 Ga0207709_10054634 3300025935 Bacteria 2463
83 Ga0207661_10228036 3300025944 Bacteria 1649
84 Ga0207679_10073644 3300025945 Bacteria 2585
85 Ga0207658_10012069 3300025986 Bacteria 5893
86 Ga0207658_10347421 3300025986 Bacteria 1291
87 Ga0207677_10135505 3300026023 Bacteria 1877
88 Ga0207678_10009890 3300026067 Bacteria 8373
89 Ga0207708_10005737 3300026075 Bacteria 9176
90 Ga0207708_10114214 3300026075 Bacteria 2099
91 Ga0207641_10089876 3300026088 Bacteria 2684
92 Ga0207648_10216889 3300026089 Bacteria 1700
93 Ga0207676_10002291 3300026095 Bacteria 13735
94 Ga0207674_10000784 3300026116 Bacteria 41387
95 Ga0207428_10001557 3300027907 Bacteria 23959
96 Ga0207428_10008450 3300027907 Bacteria 9294
97 Ga0207428_10149765 3300027907 Bacteria 1776
98 Ga0268266_10001196 3300028379 Bacteria 32052
99 Ga0307513_10001984 3300031456 Bacteria 28973
100 Ga0307507_10108096 3300033179 Bacteria 2289
101 Ga0373958_0015625 3300034819 Bacteria 1344
102 Ga0373949_0018318 3300035090 Bacteria 1586
103 Ga0373961_0031676 3300035241 Bacteria 1479
104 Ga0373925_0281646 3300037068 Bacteria 1339
105 Ga0395899_0005336 3300037312 Bacteria 9982
106 Ga0395899_0015273 3300037312 Bacteria 5852
107 Ga0395899_0019256 3300037312 Bacteria 5187
108 Ga0395899_0176515 3300037312 Bacteria 1502
109 Ga0395900_0074635 3300037418 Bacteria 3486
110 Ga0395900_0102349 3300037418 Bacteria 2942
111 Ga0395898_0142622 3300037466 Bacteria 2293
112 Ga0395898_0417674 3300037466 Bacteria 1278
113 Ga0395905_0012924 3300037471 Bacteria 8026
114 Ga0395901_0005370 3300038443 Bacteria 12955
115 Ga0395901_0032956 3300038443 Bacteria 5345
116 Ga0395901_0222347 3300038443 Bacteria 1973
117 Ga0395901_0497083 3300038443 Bacteria 1242
118 Ga0451791_1073889 3300041451 Bacteria 1804
119 Ga0439450_000729 3300042008 Bacteria 4447
120 Ga0466963_0038467 3300044694 Bacteria 3128
121 Ga0495592_0187512 3300046454 Bacteria 1404
122 Ga0495603_0003241 3300046455 Bacteria 9698
123 Ga0495603_0106296 3300046455 Bacteria 1638
124 Ga0495603_0117921 3300046455 Bacteria 1547
125 Ga0495603_0129489 3300046455 Bacteria 1470
126 Ga0495607_0096905 3300046501 Bacteria 1587
127 Ga0495644_0004883 3300046523 Bacteria 5265
128 Ga0495644_0022154 3300046523 Bacteria 2422
129 Ga0495644_0026971 3300046523 Bacteria 2178
130 Ga0495640_0209173 3300046533 Bacteria 1234
131 Ga0495609_0038276 3300046538 Bacteria 2163
132 Ga0495656_0002097 3300046615 Bacteria 6586
133 Ga0495635_0096702 3300046663 Bacteria 2018
134 Ga0495669_0164217 3300046684 Bacteria 1055
135 Ga0495670_0080375 3300046691 Bacteria 1660
136 Ga0495670_0093000 3300046691 Bacteria 1545
137 Ga0495589_0097543 3300046794 Bacteria 1424
138 Ga0495636_0009634 3300047318 Bacteria 3805
139 Ga0495676_0042623 3300047321 Bacteria 3723
140 Ga0495680_0011038 3300047322 Bacteria 8025
141 Ga0495687_010633 3300047443 Bacteria 5031
142 Ga0495677_0024218 3300047445 Bacteria 2202
143 Ga0495684_0003425 3300047471 Bacteria 12434
144 Ga0496108_0240952 3300048911 Bacteria 1573
145 Ga0496109_0023557 3300048912 Bacteria 5465
146 Ga0496110_0028387 3300048913 Bacteria 4806
147 Ga0501036_0192544 3300049572 Bacteria 1716
148 Ga0501072_0164143 3300049588 Bacteria 1772
149 Ga0501072_0424881 3300049588 Bacteria 1053
150 Ga0501079_0332364 3300049741 Bacteria 1190
151 nmdc:mga05p37_17487_c1 3300050507 Bacteria 8654
152 nmdc:mga05p37_79426_c1 3300050507 Bacteria 4040
153 nmdc:mga09592_224759_c1 3300050508 Bacteria 1626
154 nmdc:mga09592_73916_c1 3300050508 Bacteria 2897
155 nmdc:mga0qj67_25145_c1 3300050509 Bacteria 4598
156 nmdc:mga06r32_143604_c1 3300050510 Bacteria 2364
157 nmdc:mga06r32_209481_c1 3300050510 Bacteria 1937
158 nmdc:mga06r32_238239_c1 3300050510 Bacteria 1807
159 nmdc:mga06r32_358145_c1 3300050510 Bacteria 1443
160 nmdc:mga08y16_15389_c1 3300050511 Bacteria 8046
161 nmdc:mga08y16_288399_c1 3300050511 Bacteria 1692
162 nmdc:mga08y16_367934_c1 3300050511 Bacteria 1475
163 nmdc:mga08y16_41090_c1 3300050511 Bacteria 4845
164 nmdc:mga08x19_25220_c1 3300050514 Bacteria 3702
165 Ga0500651_0050341 3300053093 Bacteria 2615
166 Ga0500658_0006301 3300053134 Bacteria 4405
167 Ga0500658_0053072 3300053134 Bacteria 1662
168 Ga0501082_0104890 3300060353 Bacteria 2446
169 2558909785 2558860112 Bacteria 9931328
170 2689959424 2687453737 Bacteria 11203906
171 2753263168 2751185782 Bacteria 11227053
172 2753265361 2751185782 Bacteria 11227053
173 2876375837 2876369609 Bacteria 6807521
174 2881152876 2881147464 Bacteria 7779814
175 2977872501 2977864932 Bacteria 7534097
176 Ga0068865_100119357
177 JGI24752J21851_1003144
178 rootH2_10015486
179 rootL2_10138377
180 rootH1_10070562
181 rootH1_10110857
182 rootH1_10158745
183 Ga0070670_100005252
184 Ga0070682_100178031
185 Ga0068868_100082604
186 Ga0070667_100010544
187 Ga0070667_100195569
188 Ga0070703_10013717
189 Ga0070714_100105189
190 Ga0070713_100077526
191 Ga0070700_100024344
192 Ga0070663_100007261
193 Ga0070681_10097891
194 Ga0070699_100038367
195 Ga0070679_100002712
196 Ga0070679_100351654
197 Ga0070684_100001696
198 Ga0070686_100234478
199 Ga0070665_100000454
200 Ga0070665_100207194
201 Ga0068855_100066147
202 Ga0070664_100009698
203 Ga0068857_100121352
204 Ga0068856_100090500
205 Ga0068864_100024995
206 Ga0068864_100398728
207 Ga0068870_10082032
208 Ga0068863_100014163
209 Ga0081455_10169119
210 Ga0081540_1057257
211 Ga0081539_10020328
212 Ga0075428_100016247
213 Ga0075430_100006514
214 Ga0075431_100051340
215 Ga0075431_100225488
216 Ga0075431_100287853
217 Ga0075429_100005979
218 Ga0075436_100031227
219 Ga0105240_10045415
220 Ga0105240_10154244
221 Ga0111539_10002203
222 Ga0111539_10002909
223 Ga0111539_10075755
224 Ga0111539_10291046
225 Ga0105245_10014007
226 Ga0105245_10213251
227 Ga0114129_10023802
228 Ga0114129_10031108
229 Ga0114129_10448133
230 Ga0105242_10081148
231 Ga0105242_10177037
232 Ga0105237_10052903
233 Ga0105237_10206800
234 Ga0105249_10075807
235 Ga0105239_10452125
236 Ga0105246_10006074
237 Ga0105246_10210855
238 Ga0157370_10027465
239 Ga0157369_10008645
240 Ga0163163_10022414
241 Ga0163163_10057560
242 Ga0207653_10019642
243 Ga0207643_10000948
244 Ga0207707_10010127
245 Ga0207695_10063430
246 Ga0207695_10172199
247 Ga0207671_10051042
248 Ga0207671_10237169
249 Ga0207663_10002715
250 Ga0207649_10056321
251 Ga0207652_10014181
252 Ga0207687_10008342
253 Ga0207700_10091943
254 Ga0207700_10471345
255 Ga0207664_10289241
256 Ga0207644_10037363
257 Ga0207709_10054634
258 Ga0207661_10228036
259 Ga0207679_10073644
260 Ga0207658_10012069
261 Ga0207658_10347421
262 Ga0207677_10135505
263 Ga0207678_10009890
264 Ga0207708_10005737
265 Ga0207708_10114214
266 Ga0207641_10089876
267 Ga0207648_10216889
268 Ga0207676_10002291
269 Ga0207674_10000784
270 Ga0207428_10001557
271 Ga0207428_10008450
272 Ga0207428_10149765
273 Ga0268266_10001196
274 Ga0307513_10001984
275 Ga0307507_10108096
276 Ga0373958_0015625
277 Ga0373949_0018318
278 Ga0373961_0031676
279 Ga0373925_0281646
280 Ga0395899_0005336
281 Ga0395899_0015273
282 Ga0395899_0019256
283 Ga0395899_0176515
284 Ga0395900_0074635
285 Ga0395900_0102349
286 Ga0395898_0142622
287 Ga0395898_0417674
288 Ga0395905_0012924
289 Ga0395901_0005370
290 Ga0395901_0032956
291 Ga0395901_0222347
292 Ga0395901_0497083
293 Ga0451791_1073889
294 Ga0439450_000729
295 Ga0466963_0038467
296 Ga0495592_0187512
297 Ga0495603_0003241
298 Ga0495603_0106296
299 Ga0495603_0117921
300 Ga0495603_0129489
301 Ga0495607_0096905
302 Ga0495644_0004883
303 Ga0495644_0022154
304 Ga0495644_0026971
305 Ga0495640_0209173
306 Ga0495609_0038276
307 Ga0495656_0002097
308 Ga0495635_0096702
309 Ga0495669_0164217
310 Ga0495670_0080375
311 Ga0495670_0093000
312 Ga0495589_0097543
313 Ga0495636_0009634
314 Ga0495676_0042623
315 Ga0495680_0011038
316 Ga0495687_010633
317 Ga0495677_0024218
318 Ga0495684_0003425
319 Ga0496108_0240952
320 Ga0496109_0023557
321 Ga0496110_0028387
322 Ga0501036_0192544
323 Ga0501072_0164143
324 Ga0501072_0424881
325 Ga0501079_0332364
326 nmdc:mga05p37_17487_c1
327 nmdc:mga05p37_79426_c1
328 nmdc:mga09592_224759_c1
329 nmdc:mga09592_73916_c1
330 nmdc:mga0qj67_25145_c1
331 nmdc:mga06r32_143604_c1
332 nmdc:mga06r32_209481_c1
333 nmdc:mga06r32_238239_c1
334 nmdc:mga06r32_358145_c1
335 nmdc:mga08y16_15389_c1
336 nmdc:mga08y16_288399_c1
337 nmdc:mga08y16_367934_c1
338 nmdc:mga08y16_41090_c1
339 nmdc:mga08x19_25220_c1
340 Ga0500651_0050341
341 Ga0500658_0006301
342 Ga0500658_0053072
343 Ga0501082_0104890
344 2558909785
345 2689959424
346 2753263168
347 2753265361
348 2876375837
349 2881152876
350 2977872501

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04542

Sigma70_r2

Sigma-70 region 2

21

89

0.97

PF08281

Sigma70_r4_2

Sigma-70, region 4

142

195

0.95

PF12680

SnoaL_2

SnoaL-like domain

220

321

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fgm-assembly1.cif.gz_A streptomyces coelicolor sigr region 4 0.9647 146 202
2o8x-assembly1.cif.gz_A "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9555 144 194
2o8x-assembly1.cif.gz_B "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9528 144 194
3vfz-assembly3.cif.gz_A crystal structure of -35 promoter binding domain of sigd of mycobacterium tuberculosis 0.9494 146 199
6jhe-assembly1.cif.gz_A crystal structure of bacillus subtilis sigw domain 4 in complexed with -35 element dna 0.94 151 198
ID Description Score Start End Superfamily
4cxfA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9727 146 200 1.10.10.10
2o8xA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9555 144 194 1.10.10.10
2o8xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9528 144 194 1.10.10.10
3vfzA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9494 146 199 1.10.10.10
2o8xC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.947 146 194 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7J9ZAV2-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.9734 2 335 GO:0003677
GO:0006352
GO:0016987
AF-A0A0Q6TV86-F1-model_v4 RNA polymerase subunit sigma-70 0.9711 1 335 GO:0003677
GO:0006352
GO:0016987
AF-A0A0Q6TV86-F1-model_v4 RNA polymerase subunit sigma-70 0.9654 1 335 GO:0003677
GO:0006352
GO:0016987
AF-A0A7J9ZAV2-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.9562 2 335 GO:0003677
GO:0006352
GO:0016987
AF-A0A0Q7C1Q0-F1-model_v4 RNA polymerase subunit sigma-70 0.9153 13 334 GO:0003677
GO:0006352
GO:0016987

Map