F265988

General Info

Members Datasets Scaffolds Average Seq Length
175 112 350 214

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100065280|Ga0070665_1000652804
Length 234
Sequence MGRSVGAPEEHPGSEQCPLTGGERATPGGSLNIEQRYRWIYKPLVFAASLIPFAWLLCGAFGWFGTSLGADPVKKLEHECGKWALNFLLITLAVGLFAFCYAVLHFTVYLTLDLELNFGTLFADIAKRPYITIGFLALLLLIPLAVTSTNKMMRRLGRRWQKLHRLIYVIAVLGVWHFYWQVKRDIREPLIYAGILAVLLGYRWIRAELKKPVPAAAVPAATSKSGSATAPERT

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
69 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
70 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
71 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
72 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
73 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
74 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
77 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
82 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
83 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
84 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
85 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
86 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
87 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
88 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
89 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
90 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
91 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
92 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
93 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
94 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
95 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
96 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
97 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
98 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
99 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
100 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
101 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
102 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
103 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
104 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
105 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
106 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
107 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
108 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
109 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
110 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
111 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
112 2643221593 Lysobacter sp. Root690 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0
Isolates 0.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.43
Nodule 0
Rhizoplane 2.29
Rhizosphere 86.86
Stem 0
Stem Tuber 0
Unclassified 1.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100065280 3300005548 Bacteria 3651
2 JGI25406J46586_10023885 3300003203 Bacteria 2407
3 Ga0070683_100039094 3300005329 Bacteria 4353
4 Ga0070680_100001195 3300005336 Bacteria 18711
5 Ga0070680_100007063 3300005336 Bacteria 8559
6 Ga0070680_100251318 3300005336 Bacteria 1495
7 Ga0070682_100028742 3300005337 Bacteria 3345
8 Ga0070660_100295663 3300005339 Bacteria 1327
9 Ga0070661_100296696 3300005344 Bacteria 1257
10 Ga0070709_10013919 3300005434 Bacteria 4535
11 Ga0070709_10197164 3300005434 Bacteria 1424
12 Ga0070714_100000420 3300005435 Bacteria 30876
13 Ga0070714_101135814 3300005435 Bacteria 762
14 Ga0070710_10056384 3300005437 Bacteria 2223
15 Ga0070681_10003612 3300005458 Bacteria 14508
16 Ga0070681_10005509 3300005458 Bacteria 12231
17 Ga0070681_10014996 3300005458 Bacteria 7706
18 Ga0070681_10062438 3300005458 Bacteria 3699
19 Ga0070679_100000770 3300005530 Bacteria 27803
20 Ga0070679_100158863 3300005530 Bacteria 2235
21 Ga0070684_100063415 3300005535 Bacteria 3239
22 Ga0070684_100456327 3300005535 Bacteria 1181
23 Ga0070665_100000660 3300005548 Bacteria 46496
24 Ga0068855_100002561 3300005563 Bacteria 22402
25 Ga0068855_100023520 3300005563 Bacteria 7377
26 Ga0068855_100055995 3300005563 Bacteria 4628
27 Ga0070664_100326149 3300005564 Bacteria 1392
28 Ga0068856_100005075 3300005614 Bacteria 13030
29 Ga0068856_100066366 3300005614 Bacteria 3566
30 Ga0068859_100150004 3300005617 Bacteria 2407
31 Ga0068859_100200048 3300005617 Bacteria 2082
32 Ga0068863_100060053 3300005841 Bacteria 3596
33 Ga0068858_100468772 3300005842 Bacteria 1215
34 Ga0068860_100531891 3300005843 Bacteria 1176
35 Ga0068862_100409111 3300005844 Bacteria 1271
36 Ga0081455_10305919 3300005937 Bacteria 1138
37 Ga0081539_10000060 3300005985 Bacteria 252799
38 Ga0070717_10022209 3300006028 Bacteria 5012
39 Ga0070716_100145154 3300006173 Bacteria 1519
40 Ga0070712_100167876 3300006175 Bacteria 1700
41 Ga0068871_100129703 3300006358 Bacteria 2137
42 Ga0075434_100363458 3300006871 Bacteria 1468
43 Ga0075436_100011760 3300006914 Bacteria 6008
44 Ga0097620_100150000 3300006931 Bacteria 2407
45 Ga0097620_100200064 3300006931 Bacteria 2082
46 Ga0099795_10000073 3300007788 Bacteria 17668
47 Ga0105240_10001472 3300009093 Bacteria 40169
48 Ga0105240_10002587 3300009093 Bacteria 28971
49 Ga0105240_10019233 3300009093 Bacteria 9129
50 Ga0105240_10081791 3300009093 Bacteria 3967
51 Ga0105240_10313490 3300009093 Bacteria 1790
52 Ga0111539_11273905 3300009094 Unclassified 853
53 Ga0105245_10511269 3300009098 Bacteria 1218
54 Ga0105237_10108526 3300009545 Bacteria 2767
55 Ga0105237_10114031 3300009545 Bacteria 2695
56 Ga0105237_10146016 3300009545 Bacteria 2360
57 Ga0105237_10154337 3300009545 Bacteria 2293
58 Ga0105237_10352282 3300009545 Bacteria 1476
59 Ga0105238_10018313 3300009551 Bacteria 7126
60 Ga0105238_10333934 3300009551 Bacteria 1503
61 Ga0105249_10017847 3300009553 Bacteria 6305
62 Ga0105249_10522937 3300009553 Bacteria 1234
63 Ga0099796_10000022 3300010159 Bacteria 39465
64 Ga0099796_10053537 3300010159 Bacteria 1408
65 Ga0105246_10544407 3300011119 Bacteria 993
66 Ga0157370_10004149 3300013104 Bacteria 16774
67 Ga0157370_10248598 3300013104 Bacteria 1645
68 Ga0157369_10116031 3300013105 Bacteria 2843
69 Ga0157369_10150467 3300013105 Bacteria 2460
70 Ga0157374_10253258 3300013296 Bacteria 1733
71 Ga0157372_10359061 3300013307 Bacteria 1698
72 Ga0157372_10510105 3300013307 Bacteria 1402
73 Ga0157372_10991750 3300013307 Bacteria 973
74 Ga0163163_10284522 3300014325 Bacteria 1705
75 Ga0157379_10085758 3300014968 Bacteria 2823
76 Ga0213874_10050136 3300021377 Bacteria 1278
77 Ga0207699_10050380 3300025906 Bacteria 2455
78 Ga0207707_10000195 3300025912 Bacteria 64061
79 Ga0207707_10004672 3300025912 Bacteria 12026
80 Ga0207707_10029437 3300025912 Bacteria 4801
81 Ga0207707_10152460 3300025912 Bacteria 2020
82 Ga0207707_10194733 3300025912 Bacteria 1768
83 Ga0207695_10013236 3300025913 Bacteria 9843
84 Ga0207695_10085060 3300025913 Bacteria 3192
85 Ga0207695_10226283 3300025913 Bacteria 1776
86 Ga0207671_10127912 3300025914 Bacteria 1948
87 Ga0207693_10277542 3300025915 Bacteria 1313
88 Ga0207663_10062750 3300025916 Bacteria 2363
89 Ga0207660_10023731 3300025917 Bacteria 4145
90 Ga0207660_10256508 3300025917 Bacteria 1381
91 Ga0207649_10241583 3300025920 Bacteria 1297
92 Ga0207652_10000833 3300025921 Bacteria 29375
93 Ga0207652_10144175 3300025921 Bacteria 2130
94 Ga0207652_10177983 3300025921 Bacteria 1910
95 Ga0207652_10250494 3300025921 Bacteria 1597
96 Ga0207652_10976728 3300025921 Bacteria 745
97 Ga0207694_10020886 3300025924 Bacteria 4957
98 Ga0207665_10119185 3300025939 Bacteria 1863
99 Ga0207661_10019852 3300025944 Bacteria 5015
100 Ga0207661_10029180 3300025944 Bacteria 4234
101 Ga0207667_10002770 3300025949 Bacteria 21687
102 Ga0207667_10013084 3300025949 Bacteria 9524
103 Ga0207712_10559222 3300025961 Bacteria 985
104 Ga0207702_10503880 3300026078 Bacteria 1180
105 Ga0207641_10091663 3300026088 Bacteria 2660
106 Ga0207675_100154522 3300026118 Bacteria 2186
107 Ga0207675_100818350 3300026118 Bacteria 945
108 Ga0209179_1000077 3300027512 Bacteria 15790
109 Ga0268266_10000630 3300028379 Bacteria 47949
110 Ga0268266_10706768 3300028379 Bacteria 972
111 Ga0268265_10171733 3300028380 Bacteria 1854
112 Ga0268264_10892809 3300028381 Bacteria 892
113 Ga0265331_10090424 3300031250 Bacteria 1415
114 Ga0307513_10187919 3300031456 Bacteria 1921
115 Ga0316575_10109452 3300031665 Bacteria 1127
116 Ga0316579_10230089 3300031691 Bacteria 897
117 Ga0316576_10082154 3300031727 Bacteria 2391
118 Ga0316576_10149028 3300031727 Bacteria 1763
119 Ga0316576_10202674 3300031727 Bacteria 1494
120 Ga0316577_10086211 3300031733 Bacteria 1757
121 Ga0307407_10086408 3300031903 Bacteria 1911
122 Ga0307409_100194717 3300031995 Bacteria 1808
123 Ga0307411_10826226 3300032005 Unclassified 818
124 Ga0316574_0008534 3300035398 Bacteria 5694
125 Ga0316574_0036383 3300035398 Bacteria 3013
126 Ga0316574_0078516 3300035398 Bacteria 2093
127 Ga0316574_0108208 3300035398 Bacteria 1781
128 Ga0316574_0231251 3300035398 Bacteria 1183
129 Ga0316574_0270773 3300035398 Bacteria 1083
130 Ga0316574_0391904 3300035398 Bacteria 875
131 Ga0316574_0422870 3300035398 Bacteria 837
132 Ga0373937_0203611 3300036401 Bacteria 1861
133 Ga0316582_0078579 3300036647 Bacteria 2150
134 Ga0373925_0843013 3300037068 Bacteria 756
135 Ga0436360_0041736 3300039438 Bacteria 1404
136 Ga0436360_1188600 3300039438 Bacteria 17858
137 Ga0436363_0067219 3300039450 Bacteria 1261
138 Ga0436363_0663429 3300039450 Bacteria 21503
139 Ga0436362_0546407 3300039453 Bacteria 794
140 Ga0439447_000730 3300041407 Bacteria 12185
141 Ga0450920_067578 3300042122 Bacteria 726
142 Ga0450906_029926 3300042145 Bacteria 963
143 Ga0466966_0000227 3300044684 Bacteria 37516
144 Ga0466966_0076613 3300044684 Bacteria 2088
145 Ga0466961_0001167 3300044693 Bacteria 16171
146 Ga0466961_0524827 3300044693 Bacteria 714
147 Ga0466971_0000177 3300044719 Bacteria 23913
148 Ga0466957_0046520 3300044842 Bacteria 2634
149 Ga0466959_0002223 3300045049 Bacteria 12358
150 Ga0466959_0028829 3300045049 Bacteria 4114
151 Ga0451576_0350592 3300045051 Unclassified 1545
152 Ga0466958_0218252 3300045836 Bacteria 1216
153 Ga0495668_0000710 3300046616 Bacteria 40166
154 Ga0495635_0226400 3300046663 Bacteria 1264
155 Ga0496104_0123650 3300048907 Bacteria 2484
156 Ga0496112_0292477 3300048915 Bacteria 1575
157 Ga0496115_0255893 3300048918 Bacteria 1441
158 Ga0496115_0406708 3300048918 Bacteria 1104
159 Ga0496126_0002578 3300048929 Bacteria 24191
160 nmdc:mga08x19_30284_c1 3300050514 Bacteria 3399
161 Ga0500583_0018219 3300053092 Bacteria 2848
162 Ga0500583_0075882 3300053092 Bacteria 1616
163 Ga0500641_0027475 3300053096 Bacteria 2216
164 Ga0500556_0001052 3300053104 Bacteria 14249
165 Ga0500556_0031268 3300053104 Bacteria 1810
166 Ga0500562_077962 3300053108 Bacteria 896
167 Ga0500642_0028032 3300053130 Bacteria 2319
168 Ga0500588_0003141 3300053146 Bacteria 3455
169 Ga0500616_0000016 3300053153 Bacteria 627087
170 Ga0500616_0015062 3300053153 Bacteria 4430
171 Ga0500622_0021738 3300053156 Bacteria 3403
172 Ga0500627_0227931 3300053158 Bacteria 830
173 Ga0500637_0012002 3300053178 Bacteria 4503
174 Ga0466962_0005390 3300061719 Bacteria 6153
175 2643974078 2643221593 Bacteria 6296053
176 Ga0070665_100065280
177 JGI25406J46586_10023885
178 Ga0070683_100039094
179 Ga0070680_100001195
180 Ga0070680_100007063
181 Ga0070680_100251318
182 Ga0070682_100028742
183 Ga0070660_100295663
184 Ga0070661_100296696
185 Ga0070709_10013919
186 Ga0070709_10197164
187 Ga0070714_100000420
188 Ga0070714_101135814
189 Ga0070710_10056384
190 Ga0070681_10003612
191 Ga0070681_10005509
192 Ga0070681_10014996
193 Ga0070681_10062438
194 Ga0070679_100000770
195 Ga0070679_100158863
196 Ga0070684_100063415
197 Ga0070684_100456327
198 Ga0070665_100000660
199 Ga0068855_100002561
200 Ga0068855_100023520
201 Ga0068855_100055995
202 Ga0070664_100326149
203 Ga0068856_100005075
204 Ga0068856_100066366
205 Ga0068859_100150004
206 Ga0068859_100200048
207 Ga0068863_100060053
208 Ga0068858_100468772
209 Ga0068860_100531891
210 Ga0068862_100409111
211 Ga0081455_10305919
212 Ga0081539_10000060
213 Ga0070717_10022209
214 Ga0070716_100145154
215 Ga0070712_100167876
216 Ga0068871_100129703
217 Ga0075434_100363458
218 Ga0075436_100011760
219 Ga0097620_100150000
220 Ga0097620_100200064
221 Ga0099795_10000073
222 Ga0105240_10001472
223 Ga0105240_10002587
224 Ga0105240_10019233
225 Ga0105240_10081791
226 Ga0105240_10313490
227 Ga0111539_11273905
228 Ga0105245_10511269
229 Ga0105237_10108526
230 Ga0105237_10114031
231 Ga0105237_10146016
232 Ga0105237_10154337
233 Ga0105237_10352282
234 Ga0105238_10018313
235 Ga0105238_10333934
236 Ga0105249_10017847
237 Ga0105249_10522937
238 Ga0099796_10000022
239 Ga0099796_10053537
240 Ga0105246_10544407
241 Ga0157370_10004149
242 Ga0157370_10248598
243 Ga0157369_10116031
244 Ga0157369_10150467
245 Ga0157374_10253258
246 Ga0157372_10359061
247 Ga0157372_10510105
248 Ga0157372_10991750
249 Ga0163163_10284522
250 Ga0157379_10085758
251 Ga0213874_10050136
252 Ga0207699_10050380
253 Ga0207707_10000195
254 Ga0207707_10004672
255 Ga0207707_10029437
256 Ga0207707_10152460
257 Ga0207707_10194733
258 Ga0207695_10013236
259 Ga0207695_10085060
260 Ga0207695_10226283
261 Ga0207671_10127912
262 Ga0207693_10277542
263 Ga0207663_10062750
264 Ga0207660_10023731
265 Ga0207660_10256508
266 Ga0207649_10241583
267 Ga0207652_10000833
268 Ga0207652_10144175
269 Ga0207652_10177983
270 Ga0207652_10250494
271 Ga0207652_10976728
272 Ga0207694_10020886
273 Ga0207665_10119185
274 Ga0207661_10019852
275 Ga0207661_10029180
276 Ga0207667_10002770
277 Ga0207667_10013084
278 Ga0207712_10559222
279 Ga0207702_10503880
280 Ga0207641_10091663
281 Ga0207675_100154522
282 Ga0207675_100818350
283 Ga0209179_1000077
284 Ga0268266_10000630
285 Ga0268266_10706768
286 Ga0268265_10171733
287 Ga0268264_10892809
288 Ga0265331_10090424
289 Ga0307513_10187919
290 Ga0316575_10109452
291 Ga0316579_10230089
292 Ga0316576_10082154
293 Ga0316576_10149028
294 Ga0316576_10202674
295 Ga0316577_10086211
296 Ga0307407_10086408
297 Ga0307409_100194717
298 Ga0307411_10826226
299 Ga0316574_0008534
300 Ga0316574_0036383
301 Ga0316574_0078516
302 Ga0316574_0108208
303 Ga0316574_0231251
304 Ga0316574_0270773
305 Ga0316574_0391904
306 Ga0316574_0422870
307 Ga0373937_0203611
308 Ga0316582_0078579
309 Ga0373925_0843013
310 Ga0436360_0041736
311 Ga0436360_1188600
312 Ga0436363_0067219
313 Ga0436363_0663429
314 Ga0436362_0546407
315 Ga0439447_000730
316 Ga0450920_067578
317 Ga0450906_029926
318 Ga0466966_0000227
319 Ga0466966_0076613
320 Ga0466961_0001167
321 Ga0466961_0524827
322 Ga0466971_0000177
323 Ga0466957_0046520
324 Ga0466959_0002223
325 Ga0466959_0028829
326 Ga0451576_0350592
327 Ga0466958_0218252
328 Ga0495668_0000710
329 Ga0495635_0226400
330 Ga0496104_0123650
331 Ga0496112_0292477
332 Ga0496115_0255893
333 Ga0496115_0406708
334 Ga0496126_0002578
335 nmdc:mga08x19_30284_c1
336 Ga0500583_0018219
337 Ga0500583_0075882
338 Ga0500641_0027475
339 Ga0500556_0001052
340 Ga0500556_0031268
341 Ga0500562_077962
342 Ga0500642_0028032
343 Ga0500588_0003141
344 Ga0500616_0000016
345 Ga0500616_0015062
346 Ga0500622_0021738
347 Ga0500627_0227931
348 Ga0500637_0012002
349 Ga0466962_0005390
350 2643974078

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01794

Ferric_reduct

Ferric reductase like transmembrane component

45

175

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gz3-assembly1.cif.gz_B structure of human phagocyte nadph oxidase in the resting state 0.6749 13 164
4g80-assembly1.cif.gz_S crystal structure of voltage sensing domain of ci-vsp with fragment antibody (wt, 3.8 a) 0.6681 54 164
6tt3-assembly1.cif.gz_A crystal structure of 'res_s2 mutant human angiotensin-1 converting enzyme n-domain in complex with sg6. 0.6426 43 130
7d3e-assembly1.cif.gz_C cryo-em structure of human duox1-duoxa1 in low-calcium state 0.6354 7 199
6y9b-assembly1.cif.gz_C cryo-em structure of trimeric human steap1 bound to three fab120.545 fragments 0.6275 6 194
ID Description Score Start End Superfamily
af_P76343_47_161_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.9462 51 162 1.20.950.20
af_P76343_47_161_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.9147 51 162 1.20.950.20
af_A0A1D8PQM2_150_271_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.8277 51 163 1.20.950.20
af_B8A3B5_195_317_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.8059 51 164 1.20.950.20
af_A0A1D8PQM2_150_271_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.768 51 163 1.20.950.20
ID Description Score Start End GO Terms
AF-A0A832N5Z4-F1-model_v4 Sulfoxide reductase heme-binding subunit YedZ 0.9908 38 197 GO:0005886
GO:0009055
GO:0010181
GO:0016679
GO:0020037
GO:0030091
GO:0046872
AF-A0A1G0PSN6-F1-model_v4 deleted 0.9878 14 192
AF-A0A1E4P0H7-F1-model_v4 deleted 0.9849 9 192
AF-A0A2E6PB60-F1-model_v4 Sulfoxide reductase heme-binding subunit YedZ 0.9832 41 197 GO:0005886
GO:0010181
GO:0016679
GO:0020037
AF-A0A517PAU7-F1-model_v4 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ (Flavocytochrome MsrQ) 0.9822 14 198 GO:0005886
GO:0009055
GO:0010181
GO:0016491
GO:0020037
GO:0030091
GO:0046872
GO:0051537

Map