F265959

General Info

Members Datasets Scaffolds Average Seq Length
175 125 175 132

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_100041217|Ga0070684_1000412171
Length 154
Sequence MTILSGRDPAVNVRCLPYDCAVPFTHKNLKADLEDLGSNFDGSPDLEFHAATKALELEQSGLTHQRVPPRYRFPYGHTHRTQEEVYVVVRGSGRMKVDDEIVELGEWDAVRVPPGSWRGYEAGPEGLEILIIGAPNLGENPRDDVEGTRDWWTD

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
41 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
62 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
63 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
64 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
65 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
66 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
67 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
68 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
69 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
70 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
71 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
72 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
73 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
74 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
75 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
76 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
77 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
78 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
79 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
84 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
85 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
86 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
87 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
88 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
89 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
90 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
91 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
92 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
93 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
94 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
95 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
96 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
109 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
110 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
111 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
112 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
113 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
114 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
115 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
116 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
117 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
118 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
121 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
122 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
123 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
124 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
125 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.86
Metatranscriptomes 1.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.57
Nodule 0
Rhizoplane 10.86
Rhizosphere 88
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100065299 3300005329 Bacteria 3388
2 Ga0070680_100197947 3300005336 Bacteria 1694
3 Ga0070682_100165697 3300005337 Bacteria 1531
4 Ga0070682_100424257 3300005337 Bacteria 1012
5 Ga0070687_100308563 3300005343 Bacteria 1006
6 Ga0070661_100052952 3300005344 Bacteria 2970
7 Ga0070671_100732166 3300005355 Bacteria 859
8 Ga0070688_100459591 3300005365 Bacteria 953
9 Ga0070708_100655501 3300005445 Bacteria 989
10 Ga0070663_100004510 3300005455 Bacteria 8199
11 Ga0070678_100237083 3300005456 Bacteria 1523
12 Ga0070681_10055738 3300005458 Bacteria 3935
13 Ga0070681_10088616 3300005458 Bacteria 3046
14 Ga0068867_101236361 3300005459 Unclassified 687
15 Ga0070706_100888407 3300005467 Bacteria 823
16 Ga0070679_100008398 3300005530 Bacteria 9720
17 Ga0070684_100041217 3300005535 Bacteria 3980
18 Ga0070684_100201926 3300005535 Bacteria 1811
19 Ga0070684_100583254 3300005535 Bacteria 1039
20 Ga0070686_100049392 3300005544 Bacteria 2669
21 Ga0068855_100122844 3300005563 Bacteria 2971
22 Ga0068854_100257003 3300005578 Bacteria 1397
23 Ga0068854_100300231 3300005578 Bacteria 1299
24 Ga0068854_100716374 3300005578 Bacteria 865
25 Ga0068856_100327815 3300005614 Bacteria 1549
26 Ga0068852_100022066 3300005616 Bacteria 5097
27 Ga0068861_100339667 3300005719 Bacteria 1314
28 Ga0068863_100047092 3300005841 Bacteria 4092
29 Ga0081455_10329075 3300005937 Unclassified 1085
30 Ga0070717_10696935 3300006028 Bacteria 923
31 Ga0105240_10423022 3300009093 Bacteria 1496
32 Ga0105245_10040171 3300009098 Bacteria 4167
33 Ga0105245_10246226 3300009098 Bacteria 1735
34 Ga0105243_10052224 3300009148 Bacteria 3237
35 Ga0105243_11124989 3300009148 Bacteria 795
36 Ga0105243_11203548 3300009148 Bacteria 771
37 Ga0105243_11757138 3300009148 Unclassified 650
38 Ga0105243_12595685 3300009148 Unclassified 546
39 Ga0105241_10097452 3300009174 Bacteria 2332
40 Ga0105241_10253751 3300009174 Bacteria 1492
41 Ga0105242_10132721 3300009176 Bacteria 2152
42 Ga0105248_11800361 3300009177 Bacteria 694
43 Ga0105237_10063273 3300009545 Bacteria 3697
44 Ga0105237_10121584 3300009545 Bacteria 2605
45 Ga0105237_10962976 3300009545 Bacteria 860
46 Ga0105238_12177447 3300009551 Bacteria 589
47 Ga0105239_10092689 3300010375 Bacteria 3335
48 Ga0105239_10146245 3300010375 Bacteria 2636
49 Ga0105239_10260731 3300010375 Bacteria 1948
50 Ga0105239_11564674 3300010375 Bacteria 762
51 Ga0157370_10159773 3300013104 Bacteria 2097
52 Ga0157369_11070127 3300013105 Bacteria 825
53 Ga0157374_10025949 3300013296 Bacteria 5268
54 Ga0157374_11055783 3300013296 Unclassified 832
55 Ga0163162_10982254 3300013306 Bacteria 954
56 Ga0157372_10087276 3300013307 Bacteria 3539
57 Ga0157372_10307130 3300013307 Bacteria 1846
58 Ga0157372_12914419 3300013307 Unclassified 548
59 Ga0157380_10304310 3300014326 Bacteria 1470
60 Ga0163161_10342142 3300017792 Bacteria 1187
61 Ga0206354_11078015 3300020081 Bacteria 1145
62 Ga0206353_11854417 3300020082 Bacteria 6187
63 Ga0207654_10182522 3300025911 Bacteria 1370
64 Ga0207707_10203115 3300025912 Bacteria 1728
65 Ga0207671_10555041 3300025914 Bacteria 916
66 Ga0207660_11007764 3300025917 Bacteria 679
67 Ga0207652_10000866 3300025921 Bacteria 28643
68 Ga0207687_10165454 3300025927 Bacteria 1701
69 Ga0207687_10191553 3300025927 Bacteria 1592
70 Ga0207686_10600559 3300025934 Bacteria 866
71 Ga0207686_11312616 3300025934 Bacteria 594
72 Ga0207709_10031372 3300025935 Bacteria 3103
73 Ga0207709_10984091 3300025935 Bacteria 689
74 Ga0207669_11262783 3300025937 Unclassified 627
75 Ga0207661_10037613 3300025944 Bacteria 3787
76 Ga0207712_11255516 3300025961 Unclassified 662
77 Ga0207677_10341786 3300026023 Bacteria 1251
78 Ga0207639_10174151 3300026041 Bacteria 1825
79 Ga0207678_10005203 3300026067 Bacteria 11660
80 Ga0207678_10441603 3300026067 Bacteria 1130
81 Ga0207702_10577613 3300026078 Bacteria 1101
82 Ga0207641_10023512 3300026088 Bacteria 5076
83 Ga0207674_10657383 3300026116 Bacteria 1012
84 Ga0207683_10844529 3300026121 Bacteria 850
85 Ga0265319_1011402 3300028563 Bacteria 3642
86 Ga0307408_100496033 3300031548 Unclassified 1068
87 Ga0265314_10693846 3300031711 Bacteria 515
88 Ga0307406_10162034 3300031901 Bacteria 1609
89 Ga0307409_100039182 3300031995 Bacteria 3514
90 Ga0307416_100021920 3300032002 Bacteria 4599
91 Ga0307416_101345236 3300032002 Bacteria 820
92 Ga0307415_100689612 3300032126 Unclassified 920
93 Ga0395899_0227498 3300037312 Unclassified 1289
94 Ga0395899_0703725 3300037312 Unclassified 633
95 Ga0395900_0021178 3300037418 Bacteria 6646
96 Ga0395900_0333076 3300037418 Bacteria 1495
97 Ga0395900_0369782 3300037418 Bacteria 1404
98 Ga0395898_0021217 3300037466 Bacteria 6589
99 Ga0395898_0056283 3300037466 Bacteria 3834
100 Ga0395898_1301384 3300037466 Unclassified 656
101 Ga0395905_0772816 3300037471 Bacteria 863
102 Ga0395905_1209821 3300037471 Bacteria 659
103 Ga0395901_0028667 3300038443 Bacteria 5727
104 Ga0395901_0108829 3300038443 Bacteria 2909
105 Ga0395901_0856451 3300038443 Bacteria 894
106 Ga0451793_0551268 3300041452 Bacteria 1211
107 Ga0451800_0967029 3300041459 Unclassified 729
108 Ga0450910_101364 3300042147 Bacteria 517
109 Ga0439464_0113785 3300042439 Bacteria 830
110 Ga0466966_0086371 3300044684 Unclassified 1950
111 Ga0466963_0360644 3300044694 Bacteria 1024
112 Ga0466960_0062281 3300044901 Unclassified 1833
113 Ga0466960_0066659 3300044901 Bacteria 1781
114 Ga0466960_1041340 3300044901 Unclassified 504
115 Ga0466959_0467088 3300045049 Bacteria 855
116 Ga0466958_0060742 3300045836 Bacteria 2301
117 Ga0466967_0256597 3300045976 Bacteria 1672
118 Ga0466967_0356600 3300045976 Bacteria 1416
119 Ga0495596_0233758 3300046500 Bacteria 714
120 Ga0495656_0315003 3300046615 Bacteria 805
121 Ga0495589_0295708 3300046794 Bacteria 751
122 Ga0496102_0047544 3300048905 Bacteria 3900
123 Ga0496102_0642961 3300048905 Bacteria 984
124 Ga0496102_0876564 3300048905 Bacteria 819
125 Ga0496104_0727885 3300048907 Bacteria 899
126 Ga0496106_0916947 3300048909 Unclassified 691
127 Ga0496106_0930127 3300048909 Bacteria 686
128 Ga0496108_0003427 3300048911 Bacteria 12718
129 Ga0496109_0220021 3300048912 Bacteria 1786
130 Ga0496109_1146919 3300048912 Bacteria 714
131 Ga0496109_1273618 3300048912 Unclassified 671
132 Ga0496110_0592110 3300048913 Bacteria 1006
133 Ga0496112_0558567 3300048915 Bacteria 1078
134 Ga0496112_1113824 3300048915 Unclassified 707
135 Ga0496112_1280879 3300048915 Unclassified 649
136 Ga0496113_0510750 3300048916 Bacteria 965
137 Ga0496113_1137049 3300048916 Unclassified 611
138 Ga0496114_0685714 3300048917 Bacteria 899
139 Ga0496126_0629190 3300048929 Unclassified 842
140 Ga0501031_0013142 3300049568 Bacteria 5401
141 Ga0501032_0004508 3300049569 Bacteria 10479
142 Ga0501032_0749809 3300049569 Bacteria 618
143 Ga0501033_0005096 3300049570 Bacteria 10452
144 Ga0501034_0005563 3300049571 Bacteria 13731
145 Ga0501034_0065452 3300049571 Bacteria 3647
146 Ga0501034_1469204 3300049571 Bacteria 556
147 Ga0501036_0002841 3300049572 Bacteria 13728
148 Ga0501037_0004216 3300049573 Bacteria 10429
149 Ga0501038_0004036 3300049574 Bacteria 13645
150 Ga0501040_0078846 3300049576 Bacteria 2279
151 Ga0501043_0003124 3300049579 Bacteria 13731
152 Ga0501043_1121195 3300049579 Bacteria 555
153 Ga0501046_0006332 3300049580 Bacteria 10489
154 Ga0501047_0004086 3300049581 Bacteria 13731
155 Ga0501048_0004772 3300049582 Bacteria 10328
156 Ga0501067_0621325 3300049583 Bacteria 606
157 Ga0501069_0036790 3300049585 Bacteria 2700
158 Ga0501070_0003435 3300049586 Bacteria 13731
159 Ga0501070_0501639 3300049586 Bacteria 975
160 Ga0501072_0065279 3300049588 Bacteria 2870
161 Ga0501073_0004542 3300049589 Bacteria 10437
162 Ga0501074_0008978 3300049590 Bacteria 7252
163 Ga0501077_0896008 3300049593 Bacteria 571
164 Ga0501079_0004836 3300049741 Bacteria 9979
165 Ga0501080_0011924 3300049742 Bacteria 7960
166 Ga0501080_0148984 3300049742 Bacteria 2164
167 Ga0501083_0004065 3300049744 Bacteria 10293
168 Ga0501035_0004174 3300049822 Bacteria 13731
169 Ga0501044_0005746 3300049823 Bacteria 13731
170 Ga0501045_0277658 3300049824 Bacteria 1247
171 Ga0500595_032439 3300053119 Bacteria 1744
172 Ga0501084_0019763 3300054114 Bacteria 5613
173 Ga0590075_019301 3300059424 Bacteria 1691
174 Ga0590077_024161 3300059426 Bacteria 1305
175 Ga0501082_0038839 3300060353 Bacteria 4106

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_1209821 Ga0395905_1209821_15_344 107
2 3300048917 Ga0496114_0685714 Ga0496114_0685714_556_885 107
3 3300049593 Ga0501077_0896008 Ga0501077_0896008_228_557 107
4 3300044684 Ga0466966_0086371 Ga0466966_0086371_108_572 120
5 3300045049 Ga0466959_0467088 Ga0466959_0467088_12_458 120
6 3300048929 Ga0496126_0629190 Ga0496126_0629190_341_748 122
7 3300049569 Ga0501032_0749809 Ga0501032_0749809_138_551 123
8 3300049742 Ga0501080_0148984 Ga0501080_0148984_1025_1438 123
9 3300005937 Ga0081455_10329075 Ga0081455_103290752 125
10 3300005337 Ga0070682_100424257 Ga0070682_1004242572 126
11 3300005343 Ga0070687_100308563 Ga0070687_1003085631 126
12 3300005355 Ga0070671_100732166 Ga0070671_1007321662 126
13 3300005365 Ga0070688_100459591 Ga0070688_1004595912 126
14 3300005445 Ga0070708_100655501 Ga0070708_1006555013 126
15 3300005456 Ga0070678_100237083 Ga0070678_1002370834 126
16 3300005459 Ga0068867_101236361 Ga0068867_1012363611 126
17 3300005544 Ga0070686_100049392 Ga0070686_1000493924 126
18 3300005578 Ga0068854_100716374 Ga0068854_1007163741 126
19 3300009098 Ga0105245_10246226 Ga0105245_102462263 126
20 3300009148 Ga0105243_11124989 Ga0105243_111249891 126
21 3300009148 Ga0105243_12595685 Ga0105243_125956851 126
22 3300009177 Ga0105248_11800361 Ga0105248_118003611 126
23 3300010375 Ga0105239_11564674 Ga0105239_115646742 126
24 3300013296 Ga0157374_11055783 Ga0157374_110557832 126
25 3300013307 Ga0157372_12914419 Ga0157372_129144192 126
26 3300017792 Ga0163161_10342142 Ga0163161_103421422 126
27 3300025927 Ga0207687_10165454 Ga0207687_101654544 126
28 3300025934 Ga0207686_11312616 Ga0207686_113126161 126
29 3300025937 Ga0207669_11262783 Ga0207669_112627832 126
30 3300025961 Ga0207712_11255516 Ga0207712_112555162 126
31 3300026067 Ga0207678_10441603 Ga0207678_104416032 126
32 3300026121 Ga0207683_10844529 Ga0207683_108445292 126
33 3300031548 Ga0307408_100496033 Ga0307408_1004960332 126
34 3300031901 Ga0307406_10162034 Ga0307406_101620342 126
35 3300031995 Ga0307409_100039182 Ga0307409_1000391823 126
36 3300032002 Ga0307416_100021920 Ga0307416_1000219203 126
37 3300032126 Ga0307415_100689612 Ga0307415_1006896121 126
38 3300037312 Ga0395899_0227498 Ga0395899_0227498_842_1231 126
39 3300037418 Ga0395900_0333076 Ga0395900_0333076_63_452 126
40 3300037466 Ga0395898_0056283 Ga0395898_0056283_3310_3699 126
41 3300038443 Ga0395901_0108829 Ga0395901_0108829_919_1308 126
42 3300041452 Ga0451793_0551268 Ga0451793_0551268_779_1183 126
43 3300041459 Ga0451800_0967029 Ga0451800_0967029_320_709 126
44 3300046794 Ga0495589_0295708 Ga0495589_0295708_134_520 126
45 3300048905 Ga0496102_0642961 Ga0496102_0642961_330_716 126
46 3300048905 Ga0496102_0876564 Ga0496102_0876564_146_535 126
47 3300048907 Ga0496104_0727885 Ga0496104_0727885_294_683 126
48 3300048912 Ga0496109_0220021 Ga0496109_0220021_660_1049 126
49 3300048916 Ga0496113_0510750 Ga0496113_0510750_449_838 126
50 3300005719 Ga0068861_100339667 Ga0068861_1003396673 127
51 3300009148 Ga0105243_11757138 Ga0105243_117571381 127
52 3300013306 Ga0163162_10982254 Ga0163162_109822541 127
53 3300014326 Ga0157380_10304310 Ga0157380_103043102 127
54 3300025935 Ga0207709_10984091 Ga0207709_109840912 127
55 3300032002 Ga0307416_101345236 Ga0307416_1013452361 127
56 3300037312 Ga0395899_0703725 Ga0395899_0703725_174_590 127
57 3300037418 Ga0395900_0021178 Ga0395900_0021178_440_832 127
58 3300037418 Ga0395900_0369782 Ga0395900_0369782_652_1044 127
59 3300037466 Ga0395898_0021217 Ga0395898_0021217_4427_4819 127
60 3300037466 Ga0395898_1301384 Ga0395898_1301384_69_461 127
61 3300037471 Ga0395905_0772816 Ga0395905_0772816_165_557 127
62 3300038443 Ga0395901_0028667 Ga0395901_0028667_2736_3128 127
63 3300038443 Ga0395901_0856451 Ga0395901_0856451_387_779 127
64 3300042147 Ga0450910_101364 Ga0450910_101364_102_494 127
65 3300042439 Ga0439464_0113785 Ga0439464_0113785_131_523 127
66 3300044901 Ga0466960_0062281 Ga0466960_0062281_979_1380 127
67 3300044901 Ga0466960_1041340 Ga0466960_1041340_74_466 127
68 3300045976 Ga0466967_0256597 Ga0466967_0256597_860_1252 127
69 3300046615 Ga0495656_0315003 Ga0495656_0315003_25_417 127
70 3300048905 Ga0496102_0047544 Ga0496102_0047544_1659_2048 127
71 3300048909 Ga0496106_0930127 Ga0496106_0930127_117_509 127
72 3300048912 Ga0496109_1273618 Ga0496109_1273618_259_651 127
73 3300048915 Ga0496112_0558567 Ga0496112_0558567_565_957 127
74 3300049583 Ga0501067_0621325 Ga0501067_0621325_147_581 127
75 3300046500 Ga0495596_0233758 Ga0495596_0233758_223_654 128
76 3300048915 Ga0496112_1280879 Ga0496112_1280879_115_507 128
77 3300059424 Ga0590075_019301 Ga0590075_019301_1184_1576 128
78 3300059426 Ga0590077_024161 Ga0590077_024161_597_989 128
79 3300005336 Ga0070680_100197947 Ga0070680_1001979472 131
80 3300005455 Ga0070663_100004510 Ga0070663_1000045103 131
81 3300005458 Ga0070681_10088616 Ga0070681_100886162 131
82 3300005467 Ga0070706_100888407 Ga0070706_1008884071 131
83 3300005530 Ga0070679_100008398 Ga0070679_1000083986 131
84 3300005535 Ga0070684_100041217 Ga0070684_1000412171 131
85 3300005578 Ga0068854_100257003 Ga0068854_1002570032 131
86 3300005614 Ga0068856_100327815 Ga0068856_1003278153 131
87 3300005841 Ga0068863_100047092 Ga0068863_1000470925 131
88 3300006028 Ga0070717_10696935 Ga0070717_106969352 131
89 3300009098 Ga0105245_10040171 Ga0105245_100401712 131
90 3300009148 Ga0105243_10052224 Ga0105243_100522242 131
91 3300009174 Ga0105241_10097452 Ga0105241_100974521 131
92 3300009176 Ga0105242_10132721 Ga0105242_101327211 131
93 3300009545 Ga0105237_10121584 Ga0105237_101215842 131
94 3300009545 Ga0105237_10962976 Ga0105237_109629763 131
95 3300010375 Ga0105239_10092689 Ga0105239_100926892 131
96 3300010375 Ga0105239_10260731 Ga0105239_102607313 131
97 3300013105 Ga0157369_11070127 Ga0157369_110701272 131
98 3300013296 Ga0157374_10025949 Ga0157374_100259495 131
99 3300013307 Ga0157372_10307130 Ga0157372_103071303 131
100 3300025911 Ga0207654_10182522 Ga0207654_101825221 131
101 3300025912 Ga0207707_10203115 Ga0207707_102031153 131
102 3300025914 Ga0207671_10555041 Ga0207671_105550412 131
103 3300025917 Ga0207660_11007764 Ga0207660_110077642 131
104 3300025921 Ga0207652_10000866 Ga0207652_1000086623 131
105 3300025927 Ga0207687_10191553 Ga0207687_101915532 131
106 3300025934 Ga0207686_10600559 Ga0207686_106005592 131
107 3300025935 Ga0207709_10031372 Ga0207709_100313722 131
108 3300025944 Ga0207661_10037613 Ga0207661_100376132 131
109 3300026023 Ga0207677_10341786 Ga0207677_103417862 131
110 3300026067 Ga0207678_10005203 Ga0207678_1000520311 131
111 3300026078 Ga0207702_10577613 Ga0207702_105776132 131
112 3300026088 Ga0207641_10023512 Ga0207641_100235125 131
113 3300028563 Ga0265319_1011402 Ga0265319_10114022 131
114 3300031711 Ga0265314_10693846 Ga0265314_106938461 131
115 3300044901 Ga0466960_0066659 Ga0466960_0066659_1122_1523 131
116 3300045836 Ga0466958_0060742 Ga0466958_0060742_550_951 131
117 3300045976 Ga0466967_0356600 Ga0466967_0356600_175_576 131
118 3300048909 Ga0496106_0916947 Ga0496106_0916947_211_612 131
119 3300048911 Ga0496108_0003427 Ga0496108_0003427_11715_12116 131
120 3300048913 Ga0496110_0592110 Ga0496110_0592110_113_514 131
121 3300048915 Ga0496112_1113824 Ga0496112_1113824_186_587 131
122 3300048916 Ga0496113_1137049 Ga0496113_1137049_168_569 131
123 3300049568 Ga0501031_0013142 Ga0501031_0013142_608_1009 131
124 3300049569 Ga0501032_0004508 Ga0501032_0004508_660_1061 131
125 3300049570 Ga0501033_0005096 Ga0501033_0005096_9417_9818 131
126 3300049571 Ga0501034_0005563 Ga0501034_0005563_660_1061 131
127 3300049571 Ga0501034_0065452 Ga0501034_0065452_332_733 131
128 3300049571 Ga0501034_1469204 Ga0501034_1469204_117_518 131
129 3300049572 Ga0501036_0002841 Ga0501036_0002841_12668_13069 131
130 3300049573 Ga0501037_0004216 Ga0501037_0004216_624_1025 131
131 3300049574 Ga0501038_0004036 Ga0501038_0004036_12643_13044 131
132 3300049576 Ga0501040_0078846 Ga0501040_0078846_565_966 131
133 3300049579 Ga0501043_0003124 Ga0501043_0003124_12671_13072 131
134 3300049579 Ga0501043_1121195 Ga0501043_1121195_124_525 131
135 3300049580 Ga0501046_0006332 Ga0501046_0006332_660_1061 131
136 3300049581 Ga0501047_0004086 Ga0501047_0004086_660_1061 131
137 3300049582 Ga0501048_0004772 Ga0501048_0004772_638_1039 131
138 3300049585 Ga0501069_0036790 Ga0501069_0036790_2156_2557 131
139 3300049586 Ga0501070_0003435 Ga0501070_0003435_12671_13072 131
140 3300049588 Ga0501072_0065279 Ga0501072_0065279_1905_2306 131
141 3300049589 Ga0501073_0004542 Ga0501073_0004542_9383_9784 131
142 3300049590 Ga0501074_0008978 Ga0501074_0008978_6192_6593 131
143 3300049741 Ga0501079_0004836 Ga0501079_0004836_9411_9812 131
144 3300049742 Ga0501080_0011924 Ga0501080_0011924_382_783 131
145 3300049744 Ga0501083_0004065 Ga0501083_0004065_503_904 131
146 3300049822 Ga0501035_0004174 Ga0501035_0004174_12671_13072 131
147 3300049823 Ga0501044_0005746 Ga0501044_0005746_12671_13072 131
148 3300049824 Ga0501045_0277658 Ga0501045_0277658_403_804 131
149 3300054114 Ga0501084_0019763 Ga0501084_0019763_538_939 131
150 3300060353 Ga0501082_0038839 Ga0501082_0038839_3056_3457 131
151 3300005329 Ga0070683_100065299 Ga0070683_1000652997 132
152 3300005337 Ga0070682_100165697 Ga0070682_1001656972 132
153 3300005344 Ga0070661_100052952 Ga0070661_1000529527 132
154 3300005458 Ga0070681_10055738 Ga0070681_100557381 132
155 3300005535 Ga0070684_100201926 Ga0070684_1002019263 132
156 3300005535 Ga0070684_100583254 Ga0070684_1005832542 132
157 3300005563 Ga0068855_100122844 Ga0068855_1001228442 132
158 3300005578 Ga0068854_100300231 Ga0068854_1003002313 132
159 3300005616 Ga0068852_100022066 Ga0068852_1000220666 132
160 3300009093 Ga0105240_10423022 Ga0105240_104230222 132
161 3300009148 Ga0105243_11203548 Ga0105243_112035482 132
162 3300009174 Ga0105241_10253751 Ga0105241_102537514 132
163 3300009545 Ga0105237_10063273 Ga0105237_100632736 132
164 3300009551 Ga0105238_12177447 Ga0105238_121774471 132
165 3300010375 Ga0105239_10146245 Ga0105239_101462454 132
166 3300013104 Ga0157370_10159773 Ga0157370_101597731 132
167 3300013307 Ga0157372_10087276 Ga0157372_100872763 132
168 3300020081 Ga0206354_11078015 Ga0206354_110780151 132
169 3300020082 Ga0206353_11854417 Ga0206353_1185441710 132
170 3300026041 Ga0207639_10174151 Ga0207639_101741514 132
171 3300026116 Ga0207674_10657383 Ga0207674_106573832 132
172 3300044694 Ga0466963_0360644 Ga0466963_0360644_44_448 132
173 3300048912 Ga0496109_1146919 Ga0496109_1146919_102_557 132
174 3300049586 Ga0501070_0501639 Ga0501070_0501639_244_648 132
175 3300053119 Ga0500595_032439 Ga0500595_032439_446_850 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02311

AraC_binding

AraC-like ligand binding domain

59

136

0.91

PF07883

Cupin_2

Cupin domain

63

133

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oa2-assembly1.cif.gz_A-2 crystal structure of bh2720 (10175341) from bacillus halodurans at 1.41 a resolution 0.9309 37 114
5uqp-assembly1.cif.gz_B the crystal structure of cupin protein from rhodococcus jostii rha1 0.8948 39 113
5oo8-assembly1.cif.gz_A streptomyces pac13 (h42q) with uridine 0.892 5 126
8hfb-assembly1.cif.gz_B evolved variant of quercetin 2,4-dioxygenase from bacillus subtilis 0.8896 25 113
3d82-assembly1.cif.gz_E crystal structure of a cupin-2 domain containing protein (sfri_3543) from shewanella frigidimarina ncimb 400 at 2.05 a resolution 0.8883 39 111
ID Description Score Start End Superfamily
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9151 34 113 2.60.120.10
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9121 37 123 2.60.120.10
af_Q9USR9_537_626_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9053 25 113 2.60.120.10
af_P77626_84_178_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9038 39 113 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8982 24 113 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A538GSW1-F1-model_v4 Cupin domain-containing protein 0.9746 1 131 GO:0046872
AF-A0A535CR68-F1-model_v4 Cupin domain-containing protein 0.9746 1 106
AF-A0A1M3BM55-F1-model_v4 Cupin type-2 domain-containing protein 0.971 1 129
AF-A0A5Q3L8E9-F1-model_v4 Cupin domain-containing protein 0.9685 27 114 GO:0046872
AF-A0A4R2ETW4-F1-model_v4 Cupin domain-containing protein 0.9684 27 114 GO:0046872

Feature Viewer

pLDDT pTM Quality
91.85 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map