F265797

General Info

Members Datasets Scaffolds Average Seq Length
175 130 350 128

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_101235849|Ga0070689_1012358491
Length 146
Sequence MGPAGSALTRGASVQFSFAMHSQNMAILKGLVSVAWADGRIAGEETEVLEALLLAFEATPSEAHEVRMYAREPRTLTDVPLNDLSTDARRIMLQHAVLLSFVDGHQDEKEKKLIDDLCEVLRIPAVESRGIIVAAEERARSLLKLL

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
79 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
80 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
81 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
82 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
83 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
84 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
85 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
86 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
87 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
88 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
89 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
93 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
94 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
95 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
96 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
101 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
104 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
105 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
106 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
107 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
108 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
109 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
110 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
111 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
112 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
113 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
114 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
115 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
116 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
117 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
118 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
121 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
122 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
123 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
124 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
125 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
126 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
127 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
128 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
129 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
130 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.71
Nodule 0
Rhizoplane 5.71
Rhizosphere 82.86
Stem 0
Stem Tuber 0
Unclassified 32.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_101235849 3300005340 Bacteria 671
2 rootH2_10080141 3300003320 Bacteria 2584
3 rootH2_10111364 3300003320 Bacteria 14725
4 rootL2_10278417 3300003322 Bacteria 1921
5 rootH1_10044147 3300003323 Bacteria 6466
6 rootH1_10058114 3300003323 Bacteria 5287
7 rootH1_10195103 3300003323 Unclassified 3873
8 Ga0070677_10046543 3300005333 Unclassified 1735
9 Ga0068869_101977899 3300005334 Unclassified 523
10 Ga0070682_100000246 3300005337 Bacteria 39250
11 Ga0070682_100032618 3300005337 Unclassified 3160
12 Ga0068868_100004786 3300005338 Bacteria 9503
13 Ga0070691_10450013 3300005341 Unclassified 735
14 Ga0070668_100364953 3300005347 Bacteria 1225
15 Ga0070667_101883875 3300005367 Unclassified 563
16 Ga0070694_100127124 3300005444 Bacteria 1836
17 Ga0070694_100321698 3300005444 Unclassified 1191
18 Ga0070678_100386640 3300005456 Bacteria 1212
19 Ga0070678_101887935 3300005456 Unclassified 564
20 Ga0068867_100044568 3300005459 Bacteria 3250
21 Ga0070685_10052037 3300005466 Bacteria 2369
22 Ga0070706_100087138 3300005467 Bacteria 2894
23 Ga0070707_100061290 3300005468 Bacteria 3608
24 Ga0070698_100939336 3300005471 Bacteria 811
25 Ga0070672_100009575 3300005543 Bacteria 6684
26 Ga0070672_100134391 3300005543 Bacteria 2036
27 Ga0070696_100310675 3300005546 Bacteria 1210
28 Ga0070693_100360139 3300005547 Bacteria 998
29 Ga0070665_101928999 3300005548 Unclassified 596
30 Ga0070704_100072258 3300005549 Bacteria 2509
31 Ga0068855_100001153 3300005563 Bacteria 32718
32 Ga0068855_100008551 3300005563 Bacteria 12373
33 Ga0068855_102511667 3300005563 Unclassified 512
34 Ga0068856_100064111 3300005614 Bacteria 3630
35 Ga0068856_100122596 3300005614 Bacteria 2602
36 Ga0068864_100825543 3300005618 Bacteria 912
37 Ga0068866_11074096 3300005718 Unclassified 575
38 Ga0068861_101034414 3300005719 Unclassified 786
39 Ga0068870_10216733 3300005840 Bacteria 1169
40 Ga0068863_100198328 3300005841 Unclassified 1930
41 Ga0068863_100466945 3300005841 Bacteria 1240
42 Ga0068858_101447192 3300005842 Bacteria 677
43 Ga0068862_101070905 3300005844 Unclassified 800
44 Ga0075366_10164294 3300006195 Unclassified 1346
45 Ga0097621_100060655 3300006237 Bacteria 3101
46 Ga0097621_100456067 3300006237 Bacteria 1152
47 Ga0097621_101607489 3300006237 Bacteria 618
48 Ga0068871_100017444 3300006358 Bacteria 5434
49 Ga0075428_102068685 3300006844 Bacteria 589
50 Ga0075430_101449067 3300006846 Bacteria 564
51 Ga0075431_100315837 3300006847 Bacteria 1576
52 Ga0068865_100073180 3300006881 Bacteria 2436
53 Ga0105240_10842102 3300009093 Bacteria 991
54 Ga0111539_10009108 3300009094 Bacteria 12565
55 Ga0111539_10176293 3300009094 Bacteria 2497
56 Ga0111539_11730172 3300009094 Bacteria 725
57 Ga0111539_12218855 3300009094 Unclassified 637
58 Ga0111539_12592011 3300009094 Bacteria 588
59 Ga0105245_10003300 3300009098 Bacteria 14487
60 Ga0114129_11630218 3300009147 Bacteria 789
61 Ga0105241_10034108 3300009174 Unclassified 3823
62 Ga0105237_11342687 3300009545 Unclassified 721
63 Ga0105238_10987397 3300009551 Unclassified 862
64 Ga0105238_11795171 3300009551 Unclassified 645
65 Ga0157374_11189779 3300013296 Bacteria 783
66 Ga0157378_10999569 3300013297 Bacteria 871
67 Ga0163162_13086918 3300013306 Unclassified 535
68 Ga0163163_10852379 3300014325 Bacteria 975
69 Ga0157380_10699870 3300014326 Unclassified 1018
70 Ga0157376_10122827 3300014969 Unclassified 2304
71 Ga0157376_10484848 3300014969 Unclassified 1212
72 Ga0157376_10535339 3300014969 Unclassified 1157
73 Ga0157376_11692685 3300014969 Bacteria 668
74 Ga0157376_11710321 3300014969 Bacteria 664
75 Ga0163161_10793693 3300017792 Unclassified 795
76 Ga0213876_10585015 3300021384 Bacteria 594
77 Ga0207682_10093164 3300025893 Unclassified 1309
78 Ga0207643_10217221 3300025908 Bacteria 1169
79 Ga0207684_10125974 3300025910 Bacteria 2198
80 Ga0207654_10015296 3300025911 Unclassified 3979
81 Ga0207695_11299417 3300025913 Bacteria 608
82 Ga0207687_10004859 3300025927 Bacteria 8932
83 Ga0207670_10690766 3300025936 Bacteria 844
84 Ga0207670_11085244 3300025936 Unclassified 675
85 Ga0207704_10057496 3300025938 Bacteria 2389
86 Ga0207691_10003524 3300025940 Bacteria 15224
87 Ga0207691_10195980 3300025940 Bacteria 1760
88 Ga0207689_11571466 3300025942 Unclassified 548
89 Ga0207667_10000738 3300025949 Bacteria 42549
90 Ga0207667_10033785 3300025949 Bacteria 5496
91 Ga0207667_10728201 3300025949 Unclassified 993
92 Ga0207667_10808220 3300025949 Bacteria 934
93 Ga0207667_12123133 3300025949 Unclassified 520
94 Ga0207651_11225350 3300025960 Bacteria 674
95 Ga0207668_10551800 3300025972 Bacteria 998
96 Ga0207677_10002753 3300026023 Bacteria 9281
97 Ga0207702_10057206 3300026078 Bacteria 3314
98 Ga0207702_10379880 3300026078 Unclassified 1358
99 Ga0207702_11003055 3300026078 Bacteria 828
100 Ga0207641_10338390 3300026088 Unclassified 1431
101 Ga0207648_10020786 3300026089 Bacteria 5909
102 Ga0207676_10285894 3300026095 Bacteria 1499
103 Ga0207676_11487634 3300026095 Bacteria 674
104 Ga0207683_10214566 3300026121 Bacteria 1752
105 Ga0207683_11301354 3300026121 Bacteria 673
106 Ga0207698_10916651 3300026142 Bacteria 884
107 Ga0207428_10120863 3300027907 Unclassified 2008
108 Ga0268266_10029598 3300028379 Bacteria 4655
109 Ga0268265_12123565 3300028380 Unclassified 569
110 Ga0268265_12659297 3300028380 Bacteria 506
111 Ga0265339_10000513 3300031249 Bacteria 30165
112 Ga0265316_10005974 3300031344 Bacteria 11716
113 Ga0307513_10024806 3300031456 Bacteria 6970
114 Ga0307513_10384911 3300031456 Bacteria 1141
115 Ga0307509_10440964 3300031507 Bacteria 998
116 Ga0307508_10285189 3300031616 Bacteria 1245
117 Ga0265314_10000001 3300031711 Bacteria 3792860
118 Ga0316576_10008724 3300031727 Bacteria 6490
119 Ga0316576_10749143 3300031727 Unclassified 705
120 Ga0316578_10006672 3300031728 Bacteria 5714
121 Ga0316578_10211162 3300031728 Bacteria 1168
122 Ga0316578_10404934 3300031728 Bacteria 808
123 Ga0307516_10033557 3300031730 Bacteria 5165
124 Ga0307410_10468358 3300031852 Bacteria 1031
125 Ga0307406_10011400 3300031901 Bacteria 5044
126 Ga0307412_10026200 3300031911 Bacteria 3621
127 Ga0307409_101101650 3300031995 Bacteria 815
128 Ga0307415_100063629 3300032126 Bacteria 2564
129 Ga0373945_0161724 3300035116 Unclassified 913
130 Ga0373946_0204585 3300035171 Bacteria 947
131 Ga0373955_0073154 3300035172 Unclassified 1921
132 Ga0373942_0176378 3300035207 Unclassified 698
133 Ga0316574_0032408 3300035398 Bacteria 3176
134 Ga0373927_0101600 3300035695 Bacteria 1870
135 Ga0373933_1015017 3300035724 Unclassified 546
136 Ga0373937_0902954 3300036401 Unclassified 832
137 Ga0373937_1209801 3300036401 Unclassified 704
138 Ga0316584_0074604 3300036712 Bacteria 2543
139 Ga0400489_81823 3300039093 Bacteria 1055
140 Ga0436365_0700123 3300039437 Bacteria 595
141 Ga0436361_0447116 3300039447 Bacteria 602
142 Ga0451789_0839548 3300041443 Unclassified 654
143 Ga0451791_0606164 3300041451 Bacteria 745
144 Ga0451797_0600875 3300041453 Bacteria 1526
145 Ga0451797_0617816 3300041453 Unclassified 620
146 Ga0451797_1185724 3300041453 Bacteria 1049
147 Ga0451802_1969287 3300041460 Bacteria 1591
148 Ga0451804_0611520 3300041463 Unclassified 500
149 Ga0451807_0397736 3300041486 Unclassified 737
150 Ga0451807_0543667 3300041486 Unclassified 545
151 Ga0451807_0975804 3300041486 Bacteria 9240
152 Ga0451833_0776043 3300041491 Bacteria 1093
153 Ga0451841_1273529 3300041498 Unclassified 547
154 Ga0451843_0631775 3300041509 Unclassified 528
155 Ga0439445_0080596 3300042004 Bacteria 909
156 Ga0466964_0709222 3300044706 Bacteria 561
157 Ga0466971_0187798 3300044719 Unclassified 973
158 Ga0495581_0704052 3300047315 Bacteria 582
159 Ga0495676_0160177 3300047321 Bacteria 1593
160 Ga0501034_0202209 3300049571 Bacteria 1944
161 Ga0501034_0799791 3300049571 Bacteria 836
162 Ga0501047_0281441 3300049581 Bacteria 1508
163 Ga0501080_0906410 3300049742 Bacteria 768
164 nmdc:mga0k408_89078_c1 3300050493 Unclassified 1812
165 nmdc:mga06z11_160807_c1 3300050494 Unclassified 1283
166 nmdc:mga05p37_746557_c1 3300050507 Bacteria 1079
167 nmdc:mga09592_1500828_c1 3300050508 Unclassified 548
168 nmdc:mga06r32_653636_c1 3300050510 Bacteria 1019
169 nmdc:mga08y16_158135_c1 3300050511 Bacteria 2355
170 nmdc:mga08y16_1777467_c1 3300050511 Unclassified 570
171 nmdc:mga08y16_76651_c1 3300050511 Unclassified 3485
172 nmdc:mga08x19_600891_c1 3300050514 Bacteria 780
173 Ga0495601_0429524 3300053077 Bacteria 855
174 Ga0495595_0246363 3300053084 Unclassified 894
175 Ga0501082_0837771 3300060353 Bacteria 804
176 Ga0070689_101235849
177 rootH2_10080141
178 rootH2_10111364
179 rootL2_10278417
180 rootH1_10044147
181 rootH1_10058114
182 rootH1_10195103
183 Ga0070677_10046543
184 Ga0068869_101977899
185 Ga0070682_100000246
186 Ga0070682_100032618
187 Ga0068868_100004786
188 Ga0070691_10450013
189 Ga0070668_100364953
190 Ga0070667_101883875
191 Ga0070694_100127124
192 Ga0070694_100321698
193 Ga0070678_100386640
194 Ga0070678_101887935
195 Ga0068867_100044568
196 Ga0070685_10052037
197 Ga0070706_100087138
198 Ga0070707_100061290
199 Ga0070698_100939336
200 Ga0070672_100009575
201 Ga0070672_100134391
202 Ga0070696_100310675
203 Ga0070693_100360139
204 Ga0070665_101928999
205 Ga0070704_100072258
206 Ga0068855_100001153
207 Ga0068855_100008551
208 Ga0068855_102511667
209 Ga0068856_100064111
210 Ga0068856_100122596
211 Ga0068864_100825543
212 Ga0068866_11074096
213 Ga0068861_101034414
214 Ga0068870_10216733
215 Ga0068863_100198328
216 Ga0068863_100466945
217 Ga0068858_101447192
218 Ga0068862_101070905
219 Ga0075366_10164294
220 Ga0097621_100060655
221 Ga0097621_100456067
222 Ga0097621_101607489
223 Ga0068871_100017444
224 Ga0075428_102068685
225 Ga0075430_101449067
226 Ga0075431_100315837
227 Ga0068865_100073180
228 Ga0105240_10842102
229 Ga0111539_10009108
230 Ga0111539_10176293
231 Ga0111539_11730172
232 Ga0111539_12218855
233 Ga0111539_12592011
234 Ga0105245_10003300
235 Ga0114129_11630218
236 Ga0105241_10034108
237 Ga0105237_11342687
238 Ga0105238_10987397
239 Ga0105238_11795171
240 Ga0157374_11189779
241 Ga0157378_10999569
242 Ga0163162_13086918
243 Ga0163163_10852379
244 Ga0157380_10699870
245 Ga0157376_10122827
246 Ga0157376_10484848
247 Ga0157376_10535339
248 Ga0157376_11692685
249 Ga0157376_11710321
250 Ga0163161_10793693
251 Ga0213876_10585015
252 Ga0207682_10093164
253 Ga0207643_10217221
254 Ga0207684_10125974
255 Ga0207654_10015296
256 Ga0207695_11299417
257 Ga0207687_10004859
258 Ga0207670_10690766
259 Ga0207670_11085244
260 Ga0207704_10057496
261 Ga0207691_10003524
262 Ga0207691_10195980
263 Ga0207689_11571466
264 Ga0207667_10000738
265 Ga0207667_10033785
266 Ga0207667_10728201
267 Ga0207667_10808220
268 Ga0207667_12123133
269 Ga0207651_11225350
270 Ga0207668_10551800
271 Ga0207677_10002753
272 Ga0207702_10057206
273 Ga0207702_10379880
274 Ga0207702_11003055
275 Ga0207641_10338390
276 Ga0207648_10020786
277 Ga0207676_10285894
278 Ga0207676_11487634
279 Ga0207683_10214566
280 Ga0207683_11301354
281 Ga0207698_10916651
282 Ga0207428_10120863
283 Ga0268266_10029598
284 Ga0268265_12123565
285 Ga0268265_12659297
286 Ga0265339_10000513
287 Ga0265316_10005974
288 Ga0307513_10024806
289 Ga0307513_10384911
290 Ga0307509_10440964
291 Ga0307508_10285189
292 Ga0265314_10000001
293 Ga0316576_10008724
294 Ga0316576_10749143
295 Ga0316578_10006672
296 Ga0316578_10211162
297 Ga0316578_10404934
298 Ga0307516_10033557
299 Ga0307410_10468358
300 Ga0307406_10011400
301 Ga0307412_10026200
302 Ga0307409_101101650
303 Ga0307415_100063629
304 Ga0373945_0161724
305 Ga0373946_0204585
306 Ga0373955_0073154
307 Ga0373942_0176378
308 Ga0316574_0032408
309 Ga0373927_0101600
310 Ga0373933_1015017
311 Ga0373937_0902954
312 Ga0373937_1209801
313 Ga0316584_0074604
314 Ga0400489_81823
315 Ga0436365_0700123
316 Ga0436361_0447116
317 Ga0451789_0839548
318 Ga0451791_0606164
319 Ga0451797_0600875
320 Ga0451797_0617816
321 Ga0451797_1185724
322 Ga0451802_1969287
323 Ga0451804_0611520
324 Ga0451807_0397736
325 Ga0451807_0543667
326 Ga0451807_0975804
327 Ga0451833_0776043
328 Ga0451841_1273529
329 Ga0451843_0631775
330 Ga0439445_0080596
331 Ga0466964_0709222
332 Ga0466971_0187798
333 Ga0495581_0704052
334 Ga0495676_0160177
335 Ga0501034_0202209
336 Ga0501034_0799791
337 Ga0501047_0281441
338 Ga0501080_0906410
339 nmdc:mga0k408_89078_c1
340 nmdc:mga06z11_160807_c1
341 nmdc:mga05p37_746557_c1
342 nmdc:mga09592_1500828_c1
343 nmdc:mga06r32_653636_c1
344 nmdc:mga08y16_158135_c1
345 nmdc:mga08y16_1777467_c1
346 nmdc:mga08y16_76651_c1
347 nmdc:mga08x19_600891_c1
348 Ga0495601_0429524
349 Ga0495595_0246363
350 Ga0501082_0837771

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5t2x-assembly3.cif.gz_C crystal structure of uncharacterised protein lpg1670 0.7595 69 125
5t2x-assembly1.cif.gz_A crystal structure of uncharacterised protein lpg1670 0.7591 69 125
5t2x-assembly2.cif.gz_B crystal structure of uncharacterised protein lpg1670 0.7576 69 125
2ou3-assembly1.cif.gz_B crystal structure of a tellurite resistance protein of cog3793 (npun_f6341) from nostoc punctiforme pcc 73102 at 1.85 a resolution 0.7489 5 126
2ou3-assembly1.cif.gz_B crystal structure of a tellurite resistance protein of cog3793 (npun_f6341) from nostoc punctiforme pcc 73102 at 1.85 a resolution 0.6997 5 126
ID Description Score Start End Superfamily
af_P33218_81_218_1.10.3680.10 Mainly Alpha;Orthogonal Bundle;TerB-like;TerB-like 0.78 1 123 1.10.3680.10
af_A0A1D6KUR2_12_111_1.10.1240.40 Mainly Alpha;Orthogonal Bundle;Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1;ENT domain 0.7705 68 126 1.10.1240.40
af_P31680_36_183_1.10.3680.10 Mainly Alpha;Orthogonal Bundle;TerB-like;TerB-like 0.7635 4 121 1.10.3680.10
af_P33218_81_218_1.10.3680.10 Mainly Alpha;Orthogonal Bundle;TerB-like;TerB-like 0.7489 1 123 1.10.3680.10
2ou3B01 Mainly Alpha;Orthogonal Bundle;TerB-like;TerB-like 0.7382 6 126 1.10.3680.10
ID Description Score Start End GO Terms
AF-A0A1M3MRV3-F1-model_v4 Co-chaperone DjlA N-terminal domain-containing protein 0.9663 1 126
AF-A0A1M3MRV3-F1-model_v4 Co-chaperone DjlA N-terminal domain-containing protein 0.9516 1 126
AF-A0A4Q5XIL4-F1-model_v4 TerB family tellurite resistance protein 0.9507 1 127
AF-A0A7C5N3L5-F1-model_v4 TerB family tellurite resistance protein 0.9398 1 127
AF-A0A7C5N3L5-F1-model_v4 TerB family tellurite resistance protein 0.9328 1 127

Map