F265470

General Info

Members Datasets Scaffolds Average Seq Length
174 123 348 322

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2818991460|2819677918
Length 335
Sequence IPEGTMRAMVIEKIGAPLTMQTLPIPVPQPGQVLIKVRACGVCRTDLHIIDGELSDPILPLIPGHEVIGEVVATGSPSGSLKNGEIVGVPWLAHTCGHCRYCRQQQENLCEQALFTGYTVNGGYAEFMVAWESYCVKMPALYQDAPAAPLLCAGLIGYRSWRMIPPTAHNIGIYGFGAAAHILVQIATYLNKNIYAFTKPGDVAGQVFAKKAGAIWAGNSNEASPVILDGAIIFAPDGSLIPESLSRLDKGGIVVCGGIHMSDIPSFPYQLLWEERTIKSVANLTRDDATAFFQLAPEIPLTTTVQLFPLHQANEALNQLRSGKIKGAAVLVTDN

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
38 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
61 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
62 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
63 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
64 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
65 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
66 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
67 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
68 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
69 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
70 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
71 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
72 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
73 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
74 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
75 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
76 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
77 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
78 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
79 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
80 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
81 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
82 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
83 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
84 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
85 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
86 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
87 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
88 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
89 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
90 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
91 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
92 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
93 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
94 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
95 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
96 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
97 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
98 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
99 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
100 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
101 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
102 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
110 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
111 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
112 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
113 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
114 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
115 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
116 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
117 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
118 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
119 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
120 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
121 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
122 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
123 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 0
Isolates 1.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.6
Rhizosphere 93.68
Stem 0
Stem Tuber 0
Unclassified 1.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_4055065 2162886011 Bacteria 2087
2 Ga0065712_10073728 3300005290 Unclassified 4295
3 Ga0070658_10003938 3300005327 Bacteria 12171
4 Ga0070661_100053814 3300005344 Bacteria 2947
5 Ga0070668_100014402 3300005347 Bacteria 5910
6 Ga0070667_100001384 3300005367 Bacteria 21715
7 Ga0070709_10003122 3300005434 Bacteria 8889
8 Ga0070714_100019819 3300005435 Bacteria 5485
9 Ga0070714_100061309 3300005435 Bacteria 3230
10 Ga0070713_100000715 3300005436 Bacteria 21289
11 Ga0070708_100309652 3300005445 Bacteria 1487
12 Ga0070681_10008447 3300005458 Bacteria 10079
13 Ga0070681_10039332 3300005458 Bacteria 4742
14 Ga0070706_100023359 3300005467 Bacteria 5694
15 Ga0070706_100067454 3300005467 Bacteria 3309
16 Ga0070707_100019308 3300005468 Bacteria 6419
17 Ga0070707_100261556 3300005468 Bacteria 1683
18 Ga0070698_100054900 3300005471 Bacteria 4043
19 Ga0070699_100035371 3300005518 Bacteria 4318
20 Ga0070679_100012373 3300005530 Bacteria 8152
21 Ga0070686_100372294 3300005544 Bacteria 1079
22 Ga0070695_100000152 3300005545 Bacteria 32520
23 Ga0070665_100000447 3300005548 Bacteria 60073
24 Ga0068860_100081819 3300005843 Bacteria 3071
25 Ga0068862_100004321 3300005844 Bacteria 12025
26 Ga0081455_10010210 3300005937 Bacteria 9552
27 Ga0081538_10033895 3300005981 Bacteria 3388
28 Ga0070717_10021320 3300006028 Bacteria 5104
29 Ga0070717_10027690 3300006028 Bacteria 4531
30 Ga0075428_100256274 3300006844 Bacteria 1885
31 Ga0075431_100426615 3300006847 Unclassified 1324
32 Ga0075433_10086128 3300006852 Bacteria 2774
33 Ga0075433_10127580 3300006852 Bacteria 2259
34 Ga0075433_10294191 3300006852 Bacteria 1438
35 Ga0105240_10012291 3300009093 Bacteria 11830
36 Ga0105240_10014083 3300009093 Bacteria 10928
37 Ga0105240_10156477 3300009093 Bacteria 2710
38 Ga0105240_10332869 3300009093 Bacteria 1727
39 Ga0111539_10004444 3300009094 Bacteria 18322
40 Ga0114129_10444831 3300009147 Unclassified 1701
41 Ga0105237_10022130 3300009545 Bacteria 6522
42 Ga0105238_10055805 3300009551 Bacteria 3964
43 Ga0105249_10006864 3300009553 Bacteria 9929
44 Ga0157370_10005865 3300013104 Bacteria 13710
45 Ga0157372_10011285 3300013307 Bacteria 9505
46 Ga0157379_10138679 3300014968 Bacteria 2192
47 Ga0157376_10207339 3300014969 Bacteria 1807
48 Ga0207699_10000019 3300025906 Bacteria 180307
49 Ga0207705_10004264 3300025909 Bacteria 10829
50 Ga0207684_10055910 3300025910 Bacteria 3347
51 Ga0207707_10115272 3300025912 Bacteria 2348
52 Ga0207707_10271260 3300025912 Bacteria 1470
53 Ga0207695_10212216 3300025913 Bacteria 1846
54 Ga0207693_10349618 3300025915 Bacteria 1157
55 Ga0207663_10063053 3300025916 Bacteria 2359
56 Ga0207657_10021438 3300025919 Bacteria 6080
57 Ga0207652_10005979 3300025921 Bacteria 9849
58 Ga0207646_10010178 3300025922 Bacteria 9212
59 Ga0207646_10017752 3300025922 Bacteria 6646
60 Ga0207694_10032515 3300025924 Bacteria 3994
61 Ga0207700_10001601 3300025928 Bacteria 12853
62 Ga0207700_10176559 3300025928 Bacteria 1785
63 Ga0207664_10069019 3300025929 Bacteria 2841
64 Ga0207664_10237125 3300025929 Bacteria 1587
65 Ga0207667_10454175 3300025949 Bacteria 1302
66 Ga0207712_10001067 3300025961 Bacteria 19225
67 Ga0207668_10012856 3300025972 Bacteria 5136
68 Ga0207658_10002211 3300025986 Bacteria 14441
69 Ga0207703_10232408 3300026035 Bacteria 1654
70 Ga0207702_10116747 3300026078 Bacteria 2382
71 Ga0268266_10000316 3300028379 Bacteria 76523
72 Ga0268266_10028920 3300028379 Bacteria 4710
73 Ga0268265_10003152 3300028380 Bacteria 12005
74 Ga0268264_10029404 3300028381 Bacteria 4500
75 Ga0265318_10066182 3300028577 Bacteria 1343
76 Ga0307409_100272281 3300031995 Bacteria 1560
77 Ga0373925_0347313 3300037068 Bacteria 1204
78 Ga0395899_0061994 3300037312 Bacteria 2754
79 Ga0395899_0077165 3300037312 Bacteria 2430
80 Ga0395900_0008986 3300037418 Bacteria 10245
81 Ga0395900_0021343 3300037418 Bacteria 6620
82 Ga0395900_0023740 3300037418 Bacteria 6273
83 Ga0395900_0039858 3300037418 Bacteria 4841
84 Ga0395900_0040255 3300037418 Bacteria 4816
85 Ga0395898_0007353 3300037466 Bacteria 11692
86 Ga0395898_0015882 3300037466 Bacteria 7715
87 Ga0395898_0040651 3300037466 Bacteria 4596
88 Ga0395898_0359540 3300037466 Bacteria 1388
89 Ga0395905_0021918 3300037471 Bacteria 6042
90 Ga0395905_0057060 3300037471 Bacteria 3652
91 Ga0395905_0068114 3300037471 Bacteria 3334
92 Ga0395905_0273968 3300037471 Bacteria 1573
93 Ga0395901_0001416 3300038443 Bacteria 25049
94 Ga0395901_0003823 3300038443 Bacteria 15180
95 Ga0395901_0029107 3300038443 Bacteria 5684
96 Ga0395901_0048510 3300038443 Bacteria 4410
97 Ga0395901_0104635 3300038443 Bacteria 2970
98 Ga0395901_0161245 3300038443 Bacteria 2355
99 Ga0395901_0211927 3300038443 Bacteria 2027
100 Ga0436363_1413322 3300039450 Bacteria 4420
101 Ga0466969_0007681 3300044656 Bacteria 5732
102 Ga0466963_0005925 3300044694 Bacteria 7195
103 Ga0466963_0008221 3300044694 Bacteria 6253
104 Ga0466963_0079110 3300044694 Bacteria 2224
105 Ga0466963_0122858 3300044694 Bacteria 1788
106 Ga0466964_0007444 3300044706 Bacteria 4094
107 Ga0466964_0019538 3300044706 Bacteria 2604
108 Ga0466964_0084665 3300044706 Bacteria 1368
109 Ga0466971_0019570 3300044719 Bacteria 3007
110 Ga0466968_0011027 3300044735 Bacteria 3515
111 Ga0466957_0005738 3300044842 Bacteria 6974
112 Ga0466957_0010803 3300044842 Bacteria 5250
113 Ga0466957_0027754 3300044842 Bacteria 3365
114 Ga0466960_0024493 3300044901 Bacteria 2723
115 Ga0466960_0048233 3300044901 Bacteria 2046
116 Ga0466967_0072412 3300045976 Bacteria 3088
117 Ga0466967_0111274 3300045976 Bacteria 2516
118 Ga0466967_0168305 3300045976 Bacteria 2060
119 Ga0466967_0291865 3300045976 Bacteria 1567
120 Ga0466967_0699839 3300045976 Bacteria 1003
121 Ga0495603_0010381 3300046455 Bacteria 5639
122 Ga0495629_0008074 3300046459 Bacteria 7750
123 Ga0495608_0210708 3300046511 Bacteria 1222
124 Ga0495618_0047493 3300046514 Bacteria 2709
125 Ga0495628_0099422 3300046516 Bacteria 2247
126 Ga0495630_0127447 3300046517 Bacteria 1932
127 Ga0495630_0328773 3300046517 Bacteria 1169
128 Ga0495621_0108912 3300046539 Bacteria 1061
129 Ga0495667_0155376 3300046559 Bacteria 1472
130 Ga0495656_0001384 3300046615 Bacteria 7930
131 Ga0495635_0200528 3300046663 Bacteria 1353
132 Ga0495647_0027722 3300046681 Bacteria 2083
133 Ga0495613_0069564 3300046689 Bacteria 2566
134 Ga0495624_0015059 3300046690 Bacteria 5235
135 Ga0495636_0172975 3300047318 Bacteria 977
136 Ga0495676_0069051 3300047321 Bacteria 2728
137 Ga0495676_0101143 3300047321 Bacteria 2133
138 Ga0495676_0161483 3300047321 Bacteria 1585
139 Ga0495684_0002637 3300047471 Bacteria 14252
140 Ga0495686_0000565 3300047472 Bacteria 52684
141 Ga0496101_0329624 3300048904 Bacteria 1198
142 Ga0496102_0047658 3300048905 Bacteria 3895
143 Ga0496103_0100126 3300048906 Bacteria 1834
144 Ga0496109_0066444 3300048912 Bacteria 3302
145 Ga0496111_0040724 3300048914 Bacteria 3333
146 Ga0496112_0054877 3300048915 Bacteria 3916
147 Ga0496114_0011357 3300048917 Bacteria 7114
148 Ga0496115_0003180 3300048918 Bacteria 11800
149 Ga0501036_0175499 3300049572 Bacteria 1804
150 Ga0501037_0147420 3300049573 Bacteria 1683
151 Ga0501040_0021093 3300049576 Bacteria 4345
152 Ga0501040_0137919 3300049576 Bacteria 1717
153 Ga0501041_0078615 3300049577 Bacteria 2030
154 Ga0501042_0002312 3300049578 Bacteria 11658
155 Ga0501042_0071057 3300049578 Bacteria 2490
156 Ga0501046_0082478 3300049580 Bacteria 2483
157 Ga0501047_0177209 3300049581 Bacteria 1999
158 Ga0501072_0157289 3300049588 Bacteria 1812
159 Ga0501076_0023191 3300049592 Bacteria 4781
160 Ga0501079_0092742 3300049741 Bacteria 2340
161 Ga0501079_0213791 3300049741 Bacteria 1506
162 Ga0501045_0136542 3300049824 Bacteria 1823
163 nmdc:mga05p37_16951_c1 3300050507 Bacteria 8787
164 nmdc:mga09592_263620_c1 3300050508 Bacteria 1494
165 nmdc:mga0n895_80211_c1 3300050512 Bacteria 3251
166 nmdc:mga0a205_382785_c1 3300050515 Bacteria 1272
167 nmdc:mga0a205_86977_c1 3300050515 Bacteria 3019
168 Ga0495595_0032531 3300053084 Bacteria 2349
169 Ga0495619_0158354 3300053085 Bacteria 1563
170 Ga0590071_006739 3300059421 Bacteria 2725
171 Ga0501082_0248649 3300060353 Bacteria 1548
172 Ga0466962_0069167 3300061719 Bacteria 1686
173 2819677918 2818991460 Bacteria 7595395
174 2884792300 2884791551 Bacteria 8511252
175 MRS1b_contig_4055065
176 Ga0065712_10073728
177 Ga0070658_10003938
178 Ga0070661_100053814
179 Ga0070668_100014402
180 Ga0070667_100001384
181 Ga0070709_10003122
182 Ga0070714_100019819
183 Ga0070714_100061309
184 Ga0070713_100000715
185 Ga0070708_100309652
186 Ga0070681_10008447
187 Ga0070681_10039332
188 Ga0070706_100023359
189 Ga0070706_100067454
190 Ga0070707_100019308
191 Ga0070707_100261556
192 Ga0070698_100054900
193 Ga0070699_100035371
194 Ga0070679_100012373
195 Ga0070686_100372294
196 Ga0070695_100000152
197 Ga0070665_100000447
198 Ga0068860_100081819
199 Ga0068862_100004321
200 Ga0081455_10010210
201 Ga0081538_10033895
202 Ga0070717_10021320
203 Ga0070717_10027690
204 Ga0075428_100256274
205 Ga0075431_100426615
206 Ga0075433_10086128
207 Ga0075433_10127580
208 Ga0075433_10294191
209 Ga0105240_10012291
210 Ga0105240_10014083
211 Ga0105240_10156477
212 Ga0105240_10332869
213 Ga0111539_10004444
214 Ga0114129_10444831
215 Ga0105237_10022130
216 Ga0105238_10055805
217 Ga0105249_10006864
218 Ga0157370_10005865
219 Ga0157372_10011285
220 Ga0157379_10138679
221 Ga0157376_10207339
222 Ga0207699_10000019
223 Ga0207705_10004264
224 Ga0207684_10055910
225 Ga0207707_10115272
226 Ga0207707_10271260
227 Ga0207695_10212216
228 Ga0207693_10349618
229 Ga0207663_10063053
230 Ga0207657_10021438
231 Ga0207652_10005979
232 Ga0207646_10010178
233 Ga0207646_10017752
234 Ga0207694_10032515
235 Ga0207700_10001601
236 Ga0207700_10176559
237 Ga0207664_10069019
238 Ga0207664_10237125
239 Ga0207667_10454175
240 Ga0207712_10001067
241 Ga0207668_10012856
242 Ga0207658_10002211
243 Ga0207703_10232408
244 Ga0207702_10116747
245 Ga0268266_10000316
246 Ga0268266_10028920
247 Ga0268265_10003152
248 Ga0268264_10029404
249 Ga0265318_10066182
250 Ga0307409_100272281
251 Ga0373925_0347313
252 Ga0395899_0061994
253 Ga0395899_0077165
254 Ga0395900_0008986
255 Ga0395900_0021343
256 Ga0395900_0023740
257 Ga0395900_0039858
258 Ga0395900_0040255
259 Ga0395898_0007353
260 Ga0395898_0015882
261 Ga0395898_0040651
262 Ga0395898_0359540
263 Ga0395905_0021918
264 Ga0395905_0057060
265 Ga0395905_0068114
266 Ga0395905_0273968
267 Ga0395901_0001416
268 Ga0395901_0003823
269 Ga0395901_0029107
270 Ga0395901_0048510
271 Ga0395901_0104635
272 Ga0395901_0161245
273 Ga0395901_0211927
274 Ga0436363_1413322
275 Ga0466969_0007681
276 Ga0466963_0005925
277 Ga0466963_0008221
278 Ga0466963_0079110
279 Ga0466963_0122858
280 Ga0466964_0007444
281 Ga0466964_0019538
282 Ga0466964_0084665
283 Ga0466971_0019570
284 Ga0466968_0011027
285 Ga0466957_0005738
286 Ga0466957_0010803
287 Ga0466957_0027754
288 Ga0466960_0024493
289 Ga0466960_0048233
290 Ga0466967_0072412
291 Ga0466967_0111274
292 Ga0466967_0168305
293 Ga0466967_0291865
294 Ga0466967_0699839
295 Ga0495603_0010381
296 Ga0495629_0008074
297 Ga0495608_0210708
298 Ga0495618_0047493
299 Ga0495628_0099422
300 Ga0495630_0127447
301 Ga0495630_0328773
302 Ga0495621_0108912
303 Ga0495667_0155376
304 Ga0495656_0001384
305 Ga0495635_0200528
306 Ga0495647_0027722
307 Ga0495613_0069564
308 Ga0495624_0015059
309 Ga0495636_0172975
310 Ga0495676_0069051
311 Ga0495676_0101143
312 Ga0495676_0161483
313 Ga0495684_0002637
314 Ga0495686_0000565
315 Ga0496101_0329624
316 Ga0496102_0047658
317 Ga0496103_0100126
318 Ga0496109_0066444
319 Ga0496111_0040724
320 Ga0496112_0054877
321 Ga0496114_0011357
322 Ga0496115_0003180
323 Ga0501036_0175499
324 Ga0501037_0147420
325 Ga0501040_0021093
326 Ga0501040_0137919
327 Ga0501041_0078615
328 Ga0501042_0002312
329 Ga0501042_0071057
330 Ga0501046_0082478
331 Ga0501047_0177209
332 Ga0501072_0157289
333 Ga0501076_0023191
334 Ga0501079_0092742
335 Ga0501079_0213791
336 Ga0501045_0136542
337 nmdc:mga05p37_16951_c1
338 nmdc:mga09592_263620_c1
339 nmdc:mga0n895_80211_c1
340 nmdc:mga0a205_382785_c1
341 nmdc:mga0a205_86977_c1
342 Ga0495595_0032531
343 Ga0495619_0158354
344 Ga0590071_006739
345 Ga0501082_0248649
346 Ga0466962_0069167
347 2819677918
348 2884792300

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

29

140

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6iqd-assembly1.cif.gz_A crystal structure of alcohol dehydrogenase from geobacillus stearothermophilus 0.956 1 336
1llu-assembly1.cif.gz_A the ternary complex of pseudomonas aeruginosa alcohol dehydrogenase with its coenzyme and weak substrate 0.9521 1 336
3s2i-assembly2.cif.gz_H crystal structure of furx nadh+:furfuryl alcohol ii 0.9512 1 336
6iqd-assembly1.cif.gz_A crystal structure of alcohol dehydrogenase from geobacillus stearothermophilus 0.9504 1 336
4z6k-assembly1.cif.gz_B alcohol dehydrogenase from the antarctic psychrophile moraxella sp. tae 123 0.9499 1 341
ID Description Score Start End Superfamily
1rjwC01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9706 1 340 3.90.180.10
1rjwC01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9659 1 340 3.90.180.10
af_Q17334_7_156_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9647 2 151 3.90.180.10
2hcyB01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9574 2 336 3.90.180.10
af_P00332_5_156_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9514 2 151 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A3D5EPX3-F1-model_v4 Zinc-dependent alcohol dehydrogenase 0.9683 1 135 GO:0008270
GO:0016491
AF-A0A1I3EK78-F1-model_v4 Alcohol dehydrogenase GroES-like domain-containing protein 0.9661 1 153 GO:0004022
GO:0005737
GO:0008270
AF-A0A3D5EPX3-F1-model_v4 Zinc-dependent alcohol dehydrogenase 0.9611 1 135 GO:0008270
GO:0016491
AF-A0A7W5I6F8-F1-model_v4 deleted 0.9564 1 336
AF-A0A730N434-F1-model_v4 Alcohol dehydrogenase AdhP (EC 1.1.1.1) 0.9553 1 187 GO:0004022
GO:0008270

Map