F265469

General Info

Members Datasets Scaffolds Average Seq Length
174 142 348 339

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2818991318|2819427159
Length 365
Sequence PTQEPTVSVPDAQPGIQPAVTSETQLLVEPSSLSPRRRIVQGLLRSREFSILVVLLLVVAAATIKNPSFLLSSSGWRDLLLTPSMLIVLAVGQAAVIITRNVDLSVGSVLGLTAYLTGRLFIDHPGLPIVAVFAAGILVGGLLGLVNGLLVALARVPALVITLGTLYIYRGIVLSWAGSSRINASDLPPDFLSLGTAQVLTIPVLFIVALAVLGAVGYYLYTARSGREFYAIGSDPDAAVLYGLNVRRRVLSAFVLSGALAGLAGVVFAARYGSVSSDAGTGIELQAVAAVVIGGVAIFGGSGTVWGAALGAVLLVTINRALPMLGIPDFWQQALVGALILSAIVLDRVLAARQSRRLVEARDLP

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
20 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
21 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
26 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
36 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
52 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
53 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
54 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
55 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
56 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
57 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
58 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
59 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
60 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
61 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
62 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
63 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
64 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
65 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
66 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
67 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
68 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
69 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
70 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
71 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
72 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
73 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
74 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
75 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
76 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
77 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
78 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
79 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
80 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
81 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
82 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
83 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
84 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
85 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
86 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
87 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
88 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
89 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
90 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
91 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
96 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
97 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
98 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
99 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
100 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
101 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
102 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
103 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
104 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
105 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
106 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
107 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
108 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
109 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
110 2508501039 Frankia saprophytica CN3 Isolate Nodule
111 2643221548 Streptomyces sp. Root55 Isolate Unclassified
112 2643221615 Nocardioides sp. Root224 Isolate Unclassified
113 2643221617 Nocardioides sp. Root79 Isolate Unclassified
114 2643221620 Nocardioides sp. Root240 Isolate Unclassified
115 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
116 2643221696 Nocardioides sp. Root140 Isolate Unclassified
117 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
118 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
119 2671180195 Frankia sp. CcI49 Isolate Nodule
120 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
121 2687453737 Frankia sp. BMG5.36 Isolate Nodule
122 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
123 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
124 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
125 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
126 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
127 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
128 2773857922 Frankia sp. CcI49 Isolate Nodule
129 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
130 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
131 2808606372 Agromyces sp. 23-23 Isolate Unclassified
132 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
133 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
134 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
135 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
136 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
137 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
138 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
139 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
140 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
141 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere
142 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.89
Metatranscriptomes 0
Isolates 20.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.47
Nodule 4.02
Rhizoplane 7.47
Rhizosphere 64.37
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10001035 3300001991 Bacteria 3666
2 JGI24738J21930_10003629 3300002075 Bacteria 3870
3 Ga0070658_10103805 3300005327 Bacteria 2351
4 Ga0070683_100202758 3300005329 Bacteria 1884
5 Ga0070683_100334924 3300005329 Bacteria 1441
6 Ga0070682_100024304 3300005337 Bacteria 3604
7 Ga0068868_100006051 3300005338 Bacteria 8545
8 Ga0068868_100285040 3300005338 Bacteria 1399
9 Ga0070674_100007520 3300005356 Bacteria 6428
10 Ga0070659_100043784 3300005366 Bacteria 3502
11 Ga0070701_10032171 3300005438 Bacteria 2610
12 Ga0070700_100010943 3300005441 Bacteria 5018
13 Ga0070708_100178701 3300005445 Bacteria 1983
14 Ga0070684_100052297 3300005535 Bacteria 3552
15 Ga0070672_100003567 3300005543 Bacteria 10077
16 Ga0068855_100013168 3300005563 Bacteria 9976
17 Ga0068852_100005277 3300005616 Bacteria 9225
18 Ga0068864_100250272 3300005618 Bacteria 1645
19 Ga0068866_10008019 3300005718 Bacteria 4436
20 Ga0068861_100003114 3300005719 Bacteria 10957
21 Ga0068851_10060768 3300005834 Bacteria 1935
22 Ga0068870_10004158 3300005840 Bacteria 6207
23 Ga0081538_10000041 3300005981 Bacteria 116233
24 Ga0081539_10000637 3300005985 Bacteria 70993
25 Ga0075365_10001447 3300006038 Bacteria 10770
26 Ga0075365_10005341 3300006038 Bacteria 6919
27 Ga0075365_10066749 3300006038 Bacteria 2414
28 Ga0075364_10126169 3300006051 Bacteria 1716
29 Ga0075367_10030863 3300006178 Bacteria 3076
30 Ga0068865_100037961 3300006881 Bacteria 3257
31 Ga0111539_10239851 3300009094 Bacteria 2110
32 Ga0105245_10019580 3300009098 Bacteria 5928
33 Ga0105243_10022583 3300009148 Bacteria 4783
34 Ga0105243_10083706 3300009148 Bacteria 2610
35 Ga0105248_10000193 3300009177 Bacteria 70636
36 Ga0105248_10013265 3300009177 Bacteria 9071
37 Ga0105238_10063494 3300009551 Bacteria 3693
38 Ga0105239_10129565 3300010375 Bacteria 2805
39 Ga0157372_10061244 3300013307 Bacteria 4213
40 Ga0157375_10039441 3300013308 Bacteria 4546
41 Ga0157375_10534363 3300013308 Bacteria 1335
42 Ga0163161_10013988 3300017792 Bacteria 5588
43 Ga0207642_10008203 3300025899 Bacteria 3571
44 Ga0207643_10002906 3300025908 Bacteria 9255
45 Ga0207705_10028215 3300025909 Bacteria 4001
46 Ga0207695_10190145 3300025913 Unclassified 1970
47 Ga0207690_10051637 3300025932 Bacteria 2750
48 Ga0207709_10023074 3300025935 Bacteria 3538
49 Ga0207669_10031235 3300025937 Bacteria 2973
50 Ga0207704_10009244 3300025938 Bacteria 4745
51 Ga0207691_10028862 3300025940 Bacteria 5192
52 Ga0207711_10000268 3300025941 Bacteria 56204
53 Ga0207667_10075621 3300025949 Bacteria 3496
54 Ga0207712_10251328 3300025961 Bacteria 1429
55 Ga0207678_10112344 3300026067 Bacteria 2324
56 Ga0207678_10333001 3300026067 Bacteria 1307
57 Ga0207708_10002440 3300026075 Bacteria 13668
58 Ga0207675_100006311 3300026118 Bacteria 11252
59 Ga0207428_10133705 3300027907 Bacteria 1897
60 Ga0307515_10288673 3300028794 Bacteria 1339
61 Ga0307513_10002659 3300031456 Bacteria 24628
62 Ga0307408_100011974 3300031548 Bacteria 5742
63 Ga0307408_100051617 3300031548 Bacteria 2963
64 Ga0307405_10009791 3300031731 Bacteria 4931
65 Ga0307405_10102660 3300031731 Bacteria 1921
66 Ga0307410_10001639 3300031852 Bacteria 10287
67 Ga0307406_10004320 3300031901 Bacteria 7732
68 Ga0307407_10111611 3300031903 Bacteria 1717
69 Ga0307412_10009770 3300031911 Bacteria 5508
70 Ga0307409_100012814 3300031995 Bacteria 5361
71 Ga0307409_100023908 3300031995 Bacteria 4246
72 Ga0307416_100001583 3300032002 Bacteria 12484
73 Ga0307416_100369103 3300032002 Bacteria 1460
74 Ga0307414_10020544 3300032004 Bacteria 4119
75 Ga0307411_10021563 3300032005 Bacteria 3773
76 Ga0307411_10021877 3300032005 Bacteria 3753
77 Ga0307415_100069320 3300032126 Bacteria 2472
78 Ga0395905_0018637 3300037471 Bacteria 6584
79 Ga0439465_0067869 3300041413 Bacteria 1191
80 Ga0451789_0448198 3300041443 Bacteria 1354
81 Ga0451833_1314554 3300041491 Bacteria 2286
82 Ga0451837_0503073 3300041494 Bacteria 1763
83 Ga0451837_1031851 3300041494 Bacteria 1996
84 Ga0451843_0325057 3300041509 Bacteria 1718
85 Ga0466972_0002595 3300044658 Bacteria 8962
86 Ga0466972_0097434 3300044658 Bacteria 1393
87 Ga0466965_0003531 3300044683 Bacteria 6871
88 Ga0466965_0021133 3300044683 Bacteria 3131
89 Ga0466965_0050134 3300044683 Bacteria 2070
90 Ga0466965_0056769 3300044683 Bacteria 1950
91 Ga0466966_0034705 3300044684 Bacteria 3261
92 Ga0466961_0029667 3300044693 Bacteria 3514
93 Ga0466968_0132959 3300044735 Bacteria 1133
94 Ga0466970_0001992 3300044765 Bacteria 9879
95 Ga0466970_0006996 3300044765 Bacteria 5647
96 Ga0466970_0070337 3300044765 Bacteria 1881
97 Ga0466970_0097172 3300044765 Bacteria 1602
98 Ga0466960_0000393 3300044901 Bacteria 14907
99 Ga0466960_0000408 3300044901 Bacteria 14765
100 Ga0466960_0035640 3300044901 Bacteria 2326
101 Ga0466960_0107097 3300044901 Bacteria 1447
102 Ga0466967_0077228 3300045976 Bacteria 2997
103 Ga0466967_0137284 3300045976 Bacteria 2275
104 Ga0496101_0309208 3300048904 Bacteria 1239
105 Ga0496104_0034997 3300048907 Bacteria 4687
106 Ga0496105_0090846 3300048908 Bacteria 2522
107 Ga0496105_0119686 3300048908 Bacteria 2172
108 Ga0496107_0136998 3300048910 Bacteria 1809
109 Ga0496108_0075393 3300048911 Bacteria 2850
110 Ga0496108_0095174 3300048911 Bacteria 2535
111 Ga0496109_0077403 3300048912 Bacteria 3061
112 Ga0496110_0012149 3300048913 Bacteria 7076
113 Ga0496114_0004171 3300048917 Bacteria 11184
114 Ga0496114_0308151 3300048917 Bacteria 1398
115 Ga0496115_0054722 3300048918 Bacteria 3205
116 Ga0496117_0000451 3300048920 Bacteria 68385
117 Ga0496118_0007930 3300048921 Bacteria 11109
118 Ga0501298_017569 3300049521 Bacteria 1307
119 Ga0501031_0074682 3300049568 Bacteria 2208
120 Ga0501041_0101211 3300049577 Bacteria 1784
121 Ga0501046_0000254 3300049580 Bacteria 54677
122 Ga0501046_0082128 3300049580 Bacteria 2489
123 Ga0501047_0154847 3300049581 Bacteria 2166
124 Ga0501067_0005869 3300049583 Bacteria 6804
125 Ga0501067_0019766 3300049583 Bacteria 3728
126 Ga0501069_0147148 3300049585 Bacteria 1352
127 Ga0501044_0002420 3300049823 Bacteria 21281
128 nmdc:mga0yw44_424_c1 3300050492 Bacteria 14811
129 nmdc:mga06z11_83622_c1 3300050494 Bacteria 1718
130 nmdc:mga08y16_104334_c1 3300050511 Bacteria 2951
131 Ga0495619_0117312 3300053085 Bacteria 1823
132 Ga0495619_0119652 3300053085 Bacteria 1805
133 Ga0500650_0019619 3300053098 Bacteria 2953
134 Ga0500562_007451 3300053108 Bacteria 2760
135 Ga0500593_000046 3300053117 Bacteria 43103
136 Ga0500559_0000416 3300053136 Bacteria 30508
137 Ga0500577_0091237 3300053142 Bacteria 1231
138 Ga0500616_0001876 3300053153 Bacteria 18932
139 Ga0530510_0114911 3300061734 Bacteria 1973
140 2819427159 2818991318 Bacteria 5266538
141 2508672754 2508501039 Bacteria 9978592
142 2643759834 2643221548 Bacteria 8053412
143 2644090528 2643221615 Bacteria 5487866
144 2644100740 2643221617 Bacteria 5139111
145 2644117148 2643221620 Bacteria 5134593
146 2644320285 2643221657 Bacteria 5490246
147 2644533194 2643221696 Bacteria 5431823
148 2645722574 2643221961 Bacteria 3919167
149 2645725544 2643221962 Bacteria 3874254
150 2671834380 2671180195 Bacteria 9757215
151 2676201120 2675902999 Bacteria 9438463
152 2689961404 2687453737 Bacteria 11203906
153 2738694053 2738541272 Bacteria 6848551
154 2739327366 2738543027 Bacteria 6409078
155 2739607141 2739367654 Bacteria 6049412
156 2760304950 2758568522 Bacteria 5953541
157 2760621214 2758568621 Bacteria 5967089
158 2774845696 2773857921 Bacteria 9435764
159 2774852536 2773857922 Bacteria 9757215
160 2791913278 2791354901 Bacteria 8322202
161 2799183102 2799112218 Bacteria 4315149
162 2808899335 2808606372 Bacteria 4649509
163 2835189636 2835188231 Bacteria 3476928
164 2835189650 2835188231 Bacteria 3476928
165 2857727063 2857723135 Bacteria 4217853
166 2891326804 2891326441 Bacteria 6439512
167 2912764169 2912757875 Bacteria 7940295
168 2966603204 2966598605 Bacteria 7676064
169 3006395547 3006393351 Bacteria 6615579
170 8025531523 8025530807 Bacteria 8495698
171 8054611626 8054609563 Bacteria 5170090
172 8055037996 8055037949 Bacteria 3337834
173 8056056819 8056054917 Bacteria 5736694
174 8056579882 8056579771 Bacteria 5840325
175 JGI24743J22301_10001035
176 JGI24738J21930_10003629
177 Ga0070658_10103805
178 Ga0070683_100202758
179 Ga0070683_100334924
180 Ga0070682_100024304
181 Ga0068868_100006051
182 Ga0068868_100285040
183 Ga0070674_100007520
184 Ga0070659_100043784
185 Ga0070701_10032171
186 Ga0070700_100010943
187 Ga0070708_100178701
188 Ga0070684_100052297
189 Ga0070672_100003567
190 Ga0068855_100013168
191 Ga0068852_100005277
192 Ga0068864_100250272
193 Ga0068866_10008019
194 Ga0068861_100003114
195 Ga0068851_10060768
196 Ga0068870_10004158
197 Ga0081538_10000041
198 Ga0081539_10000637
199 Ga0075365_10001447
200 Ga0075365_10005341
201 Ga0075365_10066749
202 Ga0075364_10126169
203 Ga0075367_10030863
204 Ga0068865_100037961
205 Ga0111539_10239851
206 Ga0105245_10019580
207 Ga0105243_10022583
208 Ga0105243_10083706
209 Ga0105248_10000193
210 Ga0105248_10013265
211 Ga0105238_10063494
212 Ga0105239_10129565
213 Ga0157372_10061244
214 Ga0157375_10039441
215 Ga0157375_10534363
216 Ga0163161_10013988
217 Ga0207642_10008203
218 Ga0207643_10002906
219 Ga0207705_10028215
220 Ga0207695_10190145
221 Ga0207690_10051637
222 Ga0207709_10023074
223 Ga0207669_10031235
224 Ga0207704_10009244
225 Ga0207691_10028862
226 Ga0207711_10000268
227 Ga0207667_10075621
228 Ga0207712_10251328
229 Ga0207678_10112344
230 Ga0207678_10333001
231 Ga0207708_10002440
232 Ga0207675_100006311
233 Ga0207428_10133705
234 Ga0307515_10288673
235 Ga0307513_10002659
236 Ga0307408_100011974
237 Ga0307408_100051617
238 Ga0307405_10009791
239 Ga0307405_10102660
240 Ga0307410_10001639
241 Ga0307406_10004320
242 Ga0307407_10111611
243 Ga0307412_10009770
244 Ga0307409_100012814
245 Ga0307409_100023908
246 Ga0307416_100001583
247 Ga0307416_100369103
248 Ga0307414_10020544
249 Ga0307411_10021563
250 Ga0307411_10021877
251 Ga0307415_100069320
252 Ga0395905_0018637
253 Ga0439465_0067869
254 Ga0451789_0448198
255 Ga0451833_1314554
256 Ga0451837_0503073
257 Ga0451837_1031851
258 Ga0451843_0325057
259 Ga0466972_0002595
260 Ga0466972_0097434
261 Ga0466965_0003531
262 Ga0466965_0021133
263 Ga0466965_0050134
264 Ga0466965_0056769
265 Ga0466966_0034705
266 Ga0466961_0029667
267 Ga0466968_0132959
268 Ga0466970_0001992
269 Ga0466970_0006996
270 Ga0466970_0070337
271 Ga0466970_0097172
272 Ga0466960_0000393
273 Ga0466960_0000408
274 Ga0466960_0035640
275 Ga0466960_0107097
276 Ga0466967_0077228
277 Ga0466967_0137284
278 Ga0496101_0309208
279 Ga0496104_0034997
280 Ga0496105_0090846
281 Ga0496105_0119686
282 Ga0496107_0136998
283 Ga0496108_0075393
284 Ga0496108_0095174
285 Ga0496109_0077403
286 Ga0496110_0012149
287 Ga0496114_0004171
288 Ga0496114_0308151
289 Ga0496115_0054722
290 Ga0496117_0000451
291 Ga0496118_0007930
292 Ga0501298_017569
293 Ga0501031_0074682
294 Ga0501041_0101211
295 Ga0501046_0000254
296 Ga0501046_0082128
297 Ga0501047_0154847
298 Ga0501067_0005869
299 Ga0501067_0019766
300 Ga0501069_0147148
301 Ga0501044_0002420
302 nmdc:mga0yw44_424_c1
303 nmdc:mga06z11_83622_c1
304 nmdc:mga08y16_104334_c1
305 Ga0495619_0117312
306 Ga0495619_0119652
307 Ga0500650_0019619
308 Ga0500562_007451
309 Ga0500593_000046
310 Ga0500559_0000416
311 Ga0500577_0091237
312 Ga0500616_0001876
313 Ga0530510_0114911
314 2819427159
315 2508672754
316 2643759834
317 2644090528
318 2644100740
319 2644117148
320 2644320285
321 2644533194
322 2645722574
323 2645725544
324 2671834380
325 2676201120
326 2689961404
327 2738694053
328 2739327366
329 2739607141
330 2760304950
331 2760621214
332 2774845696
333 2774852536
334 2791913278
335 2799183102
336 2808899335
337 2835189636
338 2835189650
339 2857727063
340 2891326804
341 2912764169
342 2966603204
343 3006395547
344 8025531523
345 8054611626
346 8055037996
347 8056056819
348 8056579882

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

77

344

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.5225 48 316
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.5 48 316
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.4968 61 316
2nq2-assembly1.cif.gz_B an inward-facing conformation of a putative metal-chelate type abc transporter. 0.489 67 311
7lb8-assembly1.cif.gz_B structure of a ferrichrome importer fhucdb from e. coli 0.4818 50 288
ID Description Score Start End Superfamily
af_P0AGI1_45_314_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8873 61 309 1.10.3470.10
af_P32720_52_318_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8866 62 309 1.10.3470.10
af_P39328_55_321_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.88 63 309 1.10.3470.10
af_P37772_34_305_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8769 62 309 1.10.3470.10
af_P0AGI4_56_383_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8708 62 309 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A2U9PIC9-F1-model_v4 Autoinducer 2 import system permease protein LsrC 0.9416 69 252 GO:0005886
GO:0022857
AF-A0A354ZBA5-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9031 55 328 GO:0005886
GO:0022857
AF-A0A6M1HXI7-F1-model_v4 deleted 0.9015 127 306
AF-A0A2E6TV47-F1-model_v4 ABC transporter permease 0.8981 168 331 GO:0005886
GO:0022857
AF-A0A7X7ZYV8-F1-model_v4 deleted 0.8959 48 320

Map