F265458

General Info

Members Datasets Scaffolds Average Seq Length
174 130 348 248

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2675902999|2676201555
Length 284
Sequence QVRRPALTPGAAPAPEAGARSAATTDPAAPSATPTGPLIRVINPNTSRAMTELIGACARQVAGPGTRVEAVSPSMGPASIESHYDEALAVPGVLAEVARGEAAGAAGYVIACFGDPGLDAARELARGPVVGIAEAAMHAASLLGRSFSVVTTLARSRGRTWDLADRYGLRALCRGVRACEVPVLELETDPLANAKILTECRAAVADDEAEVVLLGCAGMADLCQALTAELGVPVIDGVAAATVLVEGLIRLGLITSPRGEYAPPPPKPYAGLLARFGAPTQPSP

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
7 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
8 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
9 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
10 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
11 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
12 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
13 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
14 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
15 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
16 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
17 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
18 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
19 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
20 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
21 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
22 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
23 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
24 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
25 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
26 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
27 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
28 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
48 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
49 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
50 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
51 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
52 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
53 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
54 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
55 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
56 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
57 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
58 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
59 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
60 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
61 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
62 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
63 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
64 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
65 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
66 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
67 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
68 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
69 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
70 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
71 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
72 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
73 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
74 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
75 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
76 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
77 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
78 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
79 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
80 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
81 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
82 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
83 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
84 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
85 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
86 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
87 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
88 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
89 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
90 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
91 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
92 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
93 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
94 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
95 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
96 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
97 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
98 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
99 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
100 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
101 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
102 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
103 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
104 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
105 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
106 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
107 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
108 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
109 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
110 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
111 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
112 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
113 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
114 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
115 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
116 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
117 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
118 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
119 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
120 2508501039 Frankia saprophytica CN3 Isolate Nodule
121 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
122 2687453737 Frankia sp. BMG5.36 Isolate Nodule
123 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
124 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
125 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
126 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
127 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
128 2922554459 Rhodococcus sp. 66b Isolate Unclassified
129 8002784119 Frankia sp. AgB1.9 Isolate Nodule
130 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.1
Metatranscriptomes 0
Isolates 6.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.34
Nodule 2.87
Rhizoplane 12.64
Rhizosphere 48.85
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10023840 3300003316 Bacteria 1229
2 Ga0070676_10300884 3300005328 Bacteria 1087
3 Ga0070682_100112826 3300005337 Bacteria 1814
4 Ga0070659_100119649 3300005366 Bacteria 2132
5 Ga0070659_100172569 3300005366 Bacteria 1772
6 Ga0070710_10000510 3300005437 Bacteria 18274
7 Ga0068855_100836931 3300005563 Bacteria 976
8 Ga0068859_100000225 3300005617 Bacteria 55690
9 Ga0068859_100001925 3300005617 Bacteria 21182
10 Ga0068863_100000396 3300005841 Bacteria 44275
11 Ga0068863_100000547 3300005841 Bacteria 38285
12 Ga0068858_100238998 3300005842 Bacteria 1723
13 Ga0068858_100730864 3300005842 Bacteria 964
14 Ga0068862_100000182 3300005844 Bacteria 69071
15 Ga0075363_100018693 3300006048 Bacteria 3456
16 Ga0075364_10006384 3300006051 Bacteria 6931
17 Ga0075370_10056886 3300006353 Bacteria 2223
18 Ga0075429_100020677 3300006880 Bacteria 5713
19 Ga0075429_100481104 3300006880 Bacteria 1088
20 Ga0097620_100000225 3300006931 Bacteria 55690
21 Ga0097620_100001925 3300006931 Bacteria 21182
22 Ga0097620_100005739 3300006931 Bacteria 12624
23 Ga0105251_10009701 3300009011 Bacteria 5658
24 Ga0105245_10248385 3300009098 Bacteria 1727
25 Ga0105245_10488971 3300009098 Bacteria 1245
26 Ga0105247_10000111 3300009101 Bacteria 83418
27 Ga0105247_10002265 3300009101 Bacteria 13222
28 Ga0105247_10049610 3300009101 Bacteria 2581
29 Ga0105243_10076162 3300009148 Bacteria 2725
30 Ga0105248_10000039 3300009177 Bacteria 179700
31 Ga0105248_10000377 3300009177 Bacteria 52002
32 Ga0105248_10628466 3300009177 Bacteria 1212
33 Ga0105249_10001220 3300009553 Bacteria 22648
34 Ga0163162_10492105 3300013306 Bacteria 1357
35 Ga0157372_10618390 3300013307 Bacteria 1262
36 Ga0157375_10078570 3300013308 Bacteria 3333
37 Ga0157380_10566157 3300014326 Bacteria 1118
38 Ga0157379_10493544 3300014968 Bacteria 1134
39 Ga0209758_1002217 3300025297 Bacteria 20247
40 Ga0207692_10000681 3300025898 Bacteria 11999
41 Ga0207710_10000107 3300025900 Bacteria 105449
42 Ga0207710_10001822 3300025900 Bacteria 10276
43 Ga0207688_10065727 3300025901 Bacteria 2050
44 Ga0207649_10071173 3300025920 Bacteria 2220
45 Ga0207659_10375618 3300025926 Bacteria 1184
46 Ga0207690_10137844 3300025932 Bacteria 1794
47 Ga0207706_10358568 3300025933 Bacteria 1267
48 Ga0207704_10250401 3300025938 Bacteria 1329
49 Ga0207691_10316207 3300025940 Bacteria 1339
50 Ga0207711_10002656 3300025941 Bacteria 15804
51 Ga0207712_10014607 3300025961 Bacteria 5056
52 Ga0207668_10035563 3300025972 Bacteria 3318
53 Ga0207677_10567268 3300026023 Bacteria 992
54 Ga0207703_10140556 3300026035 Bacteria 2095
55 Ga0207678_10249066 3300026067 Bacteria 1522
56 Ga0207641_10001530 3300026088 Bacteria 22661
57 Ga0207641_10001578 3300026088 Bacteria 22254
58 Ga0207641_10180946 3300026088 Bacteria 1931
59 Ga0207676_10287824 3300026095 Bacteria 1495
60 Ga0268265_10000177 3300028380 Bacteria 76484
61 Ga0268264_10530703 3300028381 Bacteria 1152
62 Ga0265318_10010566 3300028577 Bacteria 4013
63 Ga0265338_10295118 3300028800 Bacteria 1180
64 Ga0265340_10076779 3300031247 Bacteria 1577
65 Ga0265327_10011382 3300031251 Bacteria 6132
66 Ga0265316_10397363 3300031344 Bacteria 993
67 Ga0307513_10018977 3300031456 Bacteria 8199
68 Ga0307513_10071508 3300031456 Bacteria 3620
69 Ga0307509_10025650 3300031507 Bacteria 6579
70 Ga0307516_10023343 3300031730 Bacteria 6343
71 Ga0307516_10025549 3300031730 Bacteria 6013
72 Ga0307411_10179979 3300032005 Bacteria 1604
73 Ga0307507_10069740 3300033179 Bacteria 3195
74 Ga0307507_10091589 3300033179 Bacteria 2601
75 Ga0307507_10135884 3300033179 Bacteria 1904
76 Ga0373926_0135926 3300035083 Bacteria 933
77 Ga0373956_0024277 3300035119 Bacteria 2610
78 Ga0373927_0028031 3300035695 Bacteria 3675
79 Ga0373925_0204563 3300037068 Bacteria 1571
80 Ga0436360_0502096 3300039438 Bacteria 1194
81 Ga0436360_1084620 3300039438 Bacteria 768
82 Ga0436363_0681577 3300039450 Bacteria 988
83 Ga0436363_1676613 3300039450 Bacteria 3062
84 Ga0451787_548196 3300041441 Bacteria 1689
85 Ga0451791_0367075 3300041451 Bacteria 2708
86 Ga0451793_0217880 3300041452 Bacteria 4151
87 Ga0451795_0283690 3300041456 Bacteria 4047
88 Ga0451807_1864797 3300041486 Bacteria 1782
89 Ga0451849_1382748 3300041505 Bacteria 1716
90 Ga0451851_0619530 3300041507 Bacteria 987
91 Ga0451843_1046659 3300041509 Bacteria 1194
92 Ga0451843_1526250 3300041509 Bacteria 1143
93 Ga0466972_0110926 3300044658 Bacteria 1296
94 Ga0466972_0145870 3300044658 Bacteria 1113
95 Ga0466965_0007258 3300044683 Bacteria 5079
96 Ga0466966_0019490 3300044684 Bacteria 4463
97 Ga0466968_0090558 3300044735 Bacteria 1355
98 Ga0466959_0006320 3300045049 Bacteria 8193
99 Ga0495650_0049046 3300046471 Bacteria 1755
100 Ga0495594_0035266 3300046499 Bacteria 2725
101 Ga0495648_0016034 3300046524 Bacteria 5410
102 Ga0495622_0130794 3300046557 Bacteria 1143
103 Ga0495668_0033134 3300046616 Bacteria 2903
104 Ga0495668_0325288 3300046616 Bacteria 843
105 Ga0495635_0067476 3300046663 Bacteria 2454
106 Ga0495680_0307043 3300047322 Bacteria 1113
107 Ga0496101_0053270 3300048904 Bacteria 2918
108 Ga0496101_0382700 3300048904 Bacteria 1107
109 Ga0496102_0000055 3300048905 Bacteria 173798
110 Ga0496102_0000121 3300048905 Bacteria 112133
111 Ga0496102_0486178 3300048905 Bacteria 1156
112 Ga0496103_0000054 3300048906 Bacteria 144653
113 Ga0496103_0000220 3300048906 Bacteria 56435
114 Ga0496104_0013097 3300048907 Bacteria 7473
115 Ga0496104_0077227 3300048907 Bacteria 3173
116 Ga0496105_0055488 3300048908 Bacteria 3271
117 Ga0496105_0202002 3300048908 Bacteria 1622
118 Ga0496107_0318052 3300048910 Bacteria 1158
119 Ga0496108_0123812 3300048911 Bacteria 2219
120 Ga0496108_0124202 3300048911 Bacteria 2215
121 Ga0496108_0252510 3300048911 Bacteria 1534
122 Ga0496110_0032694 3300048913 Bacteria 4496
123 Ga0496111_0195384 3300048914 Bacteria 1504
124 Ga0496116_0000174 3300048919 Bacteria 129255
125 Ga0496116_0000210 3300048919 Bacteria 109494
126 Ga0496117_0000119 3300048920 Bacteria 173772
127 Ga0496117_0073345 3300048920 Bacteria 2284
128 Ga0496117_0087058 3300048920 Bacteria 2026
129 Ga0496117_0155612 3300048920 Bacteria 1346
130 Ga0496118_0000063 3300048921 Bacteria 214325
131 Ga0496118_0003646 3300048921 Bacteria 19128
132 Ga0496118_0005690 3300048921 Bacteria 14042
133 Ga0496118_0009312 3300048921 Bacteria 9954
134 Ga0496119_0000053 3300048922 Bacteria 182875
135 Ga0496119_0000692 3300048922 Bacteria 45151
136 Ga0496119_0006195 3300048922 Bacteria 11186
137 Ga0496120_0000467 3300048923 Bacteria 63373
138 Ga0496120_0005234 3300048923 Bacteria 10426
139 Ga0496121_0005406 3300048924 Bacteria 16400
140 Ga0496121_0007605 3300048924 Bacteria 13035
141 Ga0496121_0014016 3300048924 Bacteria 8558
142 Ga0496122_0171634 3300048925 Bacteria 1306
143 Ga0496123_0169411 3300048926 Bacteria 1154
144 Ga0496124_0013758 3300048927 Bacteria 7875
145 Ga0496125_0035070 3300048928 Bacteria 4409
146 Ga0496126_0000131 3300048929 Bacteria 173789
147 Ga0495682_0040737 3300049460 Bacteria 1703
148 nmdc:mga03n38_12710_c1 3300050490 Bacteria 3177
149 nmdc:mga00v17_1133_c1 3300050491 Bacteria 13998
150 nmdc:mga07m45_20445_c1 3300050496 Bacteria 3595
151 nmdc:mga09592_109053_c1 3300050508 Bacteria 2375
152 Ga0500647_0153484 3300053091 Bacteria 1073
153 Ga0500651_0010376 3300053093 Bacteria 5582
154 Ga0500556_0001593 3300053104 Bacteria 9039
155 Ga0500593_006931 3300053117 Bacteria 4570
156 Ga0500559_0008533 3300053136 Bacteria 4484
157 Ga0500573_0009736 3300053140 Bacteria 5347
158 Ga0500579_116007 3300053143 Bacteria 1323
159 Ga0500616_0001107 3300053153 Bacteria 27884
160 Ga0500636_0063953 3300053177 Bacteria 2143
161 Ga0500637_0104824 3300053178 Bacteria 1639
162 Ga0500596_001135 3300053735 Bacteria 5360
163 2676201555 2675902999 Bacteria 9438463
164 2508673785 2508501039 Bacteria 9978592
165 2566995883 2565956761 Bacteria 6601618
166 2689957884 2687453737 Bacteria 11203906
167 2738888628 2738541308 Bacteria 7020677
168 2774846131 2773857921 Bacteria 9435764
169 2895428021 2895427314 Bacteria 13147766
170 2904537677 2904535858 Bacteria 6308016
171 2915364942 2915358134 Bacteria 6050864
172 2922557985 2922554459 Bacteria 6683962
173 8002784154 8002784119 Bacteria 9788632
174 8047713336 8047710418 Bacteria 11023148
175 rootH1_10023840
176 Ga0070676_10300884
177 Ga0070682_100112826
178 Ga0070659_100119649
179 Ga0070659_100172569
180 Ga0070710_10000510
181 Ga0068855_100836931
182 Ga0068859_100000225
183 Ga0068859_100001925
184 Ga0068863_100000396
185 Ga0068863_100000547
186 Ga0068858_100238998
187 Ga0068858_100730864
188 Ga0068862_100000182
189 Ga0075363_100018693
190 Ga0075364_10006384
191 Ga0075370_10056886
192 Ga0075429_100020677
193 Ga0075429_100481104
194 Ga0097620_100000225
195 Ga0097620_100001925
196 Ga0097620_100005739
197 Ga0105251_10009701
198 Ga0105245_10248385
199 Ga0105245_10488971
200 Ga0105247_10000111
201 Ga0105247_10002265
202 Ga0105247_10049610
203 Ga0105243_10076162
204 Ga0105248_10000039
205 Ga0105248_10000377
206 Ga0105248_10628466
207 Ga0105249_10001220
208 Ga0163162_10492105
209 Ga0157372_10618390
210 Ga0157375_10078570
211 Ga0157380_10566157
212 Ga0157379_10493544
213 Ga0209758_1002217
214 Ga0207692_10000681
215 Ga0207710_10000107
216 Ga0207710_10001822
217 Ga0207688_10065727
218 Ga0207649_10071173
219 Ga0207659_10375618
220 Ga0207690_10137844
221 Ga0207706_10358568
222 Ga0207704_10250401
223 Ga0207691_10316207
224 Ga0207711_10002656
225 Ga0207712_10014607
226 Ga0207668_10035563
227 Ga0207677_10567268
228 Ga0207703_10140556
229 Ga0207678_10249066
230 Ga0207641_10001530
231 Ga0207641_10001578
232 Ga0207641_10180946
233 Ga0207676_10287824
234 Ga0268265_10000177
235 Ga0268264_10530703
236 Ga0265318_10010566
237 Ga0265338_10295118
238 Ga0265340_10076779
239 Ga0265327_10011382
240 Ga0265316_10397363
241 Ga0307513_10018977
242 Ga0307513_10071508
243 Ga0307509_10025650
244 Ga0307516_10023343
245 Ga0307516_10025549
246 Ga0307411_10179979
247 Ga0307507_10069740
248 Ga0307507_10091589
249 Ga0307507_10135884
250 Ga0373926_0135926
251 Ga0373956_0024277
252 Ga0373927_0028031
253 Ga0373925_0204563
254 Ga0436360_0502096
255 Ga0436360_1084620
256 Ga0436363_0681577
257 Ga0436363_1676613
258 Ga0451787_548196
259 Ga0451791_0367075
260 Ga0451793_0217880
261 Ga0451795_0283690
262 Ga0451807_1864797
263 Ga0451849_1382748
264 Ga0451851_0619530
265 Ga0451843_1046659
266 Ga0451843_1526250
267 Ga0466972_0110926
268 Ga0466972_0145870
269 Ga0466965_0007258
270 Ga0466966_0019490
271 Ga0466968_0090558
272 Ga0466959_0006320
273 Ga0495650_0049046
274 Ga0495594_0035266
275 Ga0495648_0016034
276 Ga0495622_0130794
277 Ga0495668_0033134
278 Ga0495668_0325288
279 Ga0495635_0067476
280 Ga0495680_0307043
281 Ga0496101_0053270
282 Ga0496101_0382700
283 Ga0496102_0000055
284 Ga0496102_0000121
285 Ga0496102_0486178
286 Ga0496103_0000054
287 Ga0496103_0000220
288 Ga0496104_0013097
289 Ga0496104_0077227
290 Ga0496105_0055488
291 Ga0496105_0202002
292 Ga0496107_0318052
293 Ga0496108_0123812
294 Ga0496108_0124202
295 Ga0496108_0252510
296 Ga0496110_0032694
297 Ga0496111_0195384
298 Ga0496116_0000174
299 Ga0496116_0000210
300 Ga0496117_0000119
301 Ga0496117_0073345
302 Ga0496117_0087058
303 Ga0496117_0155612
304 Ga0496118_0000063
305 Ga0496118_0003646
306 Ga0496118_0005690
307 Ga0496118_0009312
308 Ga0496119_0000053
309 Ga0496119_0000692
310 Ga0496119_0006195
311 Ga0496120_0000467
312 Ga0496120_0005234
313 Ga0496121_0005406
314 Ga0496121_0007605
315 Ga0496121_0014016
316 Ga0496122_0171634
317 Ga0496123_0169411
318 Ga0496124_0013758
319 Ga0496125_0035070
320 Ga0496126_0000131
321 Ga0495682_0040737
322 nmdc:mga03n38_12710_c1
323 nmdc:mga00v17_1133_c1
324 nmdc:mga07m45_20445_c1
325 nmdc:mga09592_109053_c1
326 Ga0500647_0153484
327 Ga0500651_0010376
328 Ga0500556_0001593
329 Ga0500593_006931
330 Ga0500559_0008533
331 Ga0500573_0009736
332 Ga0500579_116007
333 Ga0500616_0001107
334 Ga0500636_0063953
335 Ga0500637_0104824
336 Ga0500596_001135
337 2676201555
338 2508673785
339 2566995883
340 2689957884
341 2738888628
342 2774846131
343 2895428021
344 2904537677
345 2915364942
346 2922557985
347 8002784154
348 8047713336

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01177

Asp_Glu_race

Asp/Glu/Hydantoin racemase

39

245

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qvj-assembly1.cif.gz_A allantoin racemase from klebsiella pneumoniae 0.9823 1 243
3qvk-assembly1.cif.gz_A allantoin racemase from klebsiella pneumoniae 0.9822 1 243
3qvj-assembly1.cif.gz_A allantoin racemase from klebsiella pneumoniae 0.9705 1 243
3qvk-assembly1.cif.gz_A allantoin racemase from klebsiella pneumoniae 0.9704 1 243
5lfd-assembly1.cif.gz_A crystal structure of allantoin racemase from pseudomonas fluorescens allr 0.9594 1 236
ID Description Score Start End Superfamily
3qvjA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9773 1 243 3.40.50.12500
3qvjA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9652 1 243 3.40.50.12500
5lfdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9594 1 236 3.40.50.12500
5lfdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9554 1 236 3.40.50.12500
af_O74886_3_236_3.40.50.12500 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9323 3 229 3.40.50.12500
ID Description Score Start End GO Terms
AF-A0A7Z8GH71-F1-model_v4 deleted 1.003 1 104
AF-R7WQG4-F1-model_v4 Hydantoin racemase 0.9993 2 123 GO:0036361
AF-E6PNB0-F1-model_v4 Hydantoin racemase (EC 5.1.99.-) 0.9978 1 132 GO:0036361
AF-A0A7X2MTC4-F1-model_v4 Allantoin racemase (EC 5.1.99.3) 0.9975 2 129 GO:0036361
GO:0047653
AF-A0A2J4ZDS7-F1-model_v4 Asp/Glu racemase 0.997 1 146 GO:0036361

Map