F265346

General Info

Members Datasets Scaffolds Average Seq Length
174 136 174 130

Family's Representative Sequence

Representative Sequence 3300049592|Ga0501076_0530161|Ga0501076_0530161_487_942
Length 151
Sequence MAKSGSQESKSPSQLIDERIEELGDWRGEMLGRLRALVKQADPNVVEEWKWRGVPTWYHDGIVCTGETYKSVVKMTFAKGAALKDPAGQFNASLEGNTRRAIDFHEGDRIDEKALKALIRAAVALNASRPARARKTAPGGGKAAKPGKSRP

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
39 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
42 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
44 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
61 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
62 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
63 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
64 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
65 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
66 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
67 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
68 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
69 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
70 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
71 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
72 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
73 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
74 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
75 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
76 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
77 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
78 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
79 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
80 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
81 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
82 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
83 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
84 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
85 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
86 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
87 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
88 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
89 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
90 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
91 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
92 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
93 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
94 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
95 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
96 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
97 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
98 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
99 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
100 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
101 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
102 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
103 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
104 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
105 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
106 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
109 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
110 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
111 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
112 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
113 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
114 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
115 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
119 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
120 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
121 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
122 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
123 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
124 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
125 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
126 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
127 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
128 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
129 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
130 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
131 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
132 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
133 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
134 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
135 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
136 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0.57
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.45
Nodule 0
Rhizoplane 13.79
Rhizosphere 82.18
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10014814 3300002459 Bacteria 1609
2 Ga0070683_100384343 3300005329 Bacteria 1338
3 Ga0070666_10070630 3300005335 Bacteria 2376
4 Ga0070660_100119418 3300005339 Bacteria 2103
5 Ga0070689_100351749 3300005340 Bacteria 1236
6 Ga0070687_100366940 3300005343 Bacteria 934
7 Ga0070668_100230670 3300005347 Bacteria 1530
8 Ga0070668_100391385 3300005347 Bacteria 1185
9 Ga0070669_100611278 3300005353 Bacteria 914
10 Ga0070667_100057295 3300005367 Bacteria 3293
11 Ga0070667_100289618 3300005367 Bacteria 1472
12 Ga0070713_102443921 3300005436 Bacteria 505
13 Ga0070705_100368687 3300005440 Bacteria 1053
14 Ga0070694_100060506 3300005444 Bacteria 2583
15 Ga0070662_100000002 3300005457 Bacteria 253208
16 Ga0068867_102340980 3300005459 Bacteria 508
17 Ga0070706_100898969 3300005467 Bacteria 818
18 Ga0070698_100000108 3300005471 Bacteria 69455
19 Ga0070665_100001319 3300005548 Bacteria 29608
20 Ga0070704_100716436 3300005549 Bacteria 888
21 Ga0070704_101137374 3300005549 Bacteria 710
22 Ga0070664_100963711 3300005564 Bacteria 801
23 Ga0068863_100000838 3300005841 Bacteria 30841
24 Ga0068858_100066329 3300005842 Bacteria 3341
25 Ga0068860_100000035 3300005843 Bacteria 238993
26 Ga0081538_10033360 3300005981 Bacteria 3429
27 Ga0081539_10260837 3300005985 Bacteria 764
28 Ga0075365_10573930 3300006038 Bacteria 798
29 Ga0075365_11162505 3300006038 Bacteria 543
30 Ga0097621_100506466 3300006237 Bacteria 1094
31 Ga0068871_100540862 3300006358 Bacteria 1054
32 Ga0075430_100053696 3300006846 Bacteria 3392
33 Ga0075430_100254627 3300006846 Bacteria 1454
34 Ga0075434_100382147 3300006871 Bacteria 1429
35 Ga0105240_10463816 3300009093 Bacteria 1415
36 Ga0105245_10845648 3300009098 Bacteria 955
37 Ga0105245_11524204 3300009098 Bacteria 720
38 Ga0105242_10697871 3300009176 Bacteria 992
39 Ga0105246_10224487 3300011119 Bacteria 1475
40 Ga0105246_11107479 3300011119 Bacteria 723
41 Ga0105246_11655445 3300011119 Bacteria 607
42 Ga0157370_11544064 3300013104 Bacteria 597
43 Ga0157378_10045312 3300013297 Bacteria 3907
44 Ga0163162_11390385 3300013306 Bacteria 798
45 Ga0163162_12018869 3300013306 Bacteria 661
46 Ga0163163_10046987 3300014325 Bacteria 4241
47 Ga0163163_10720686 3300014325 Bacteria 1061
48 Ga0163163_11103975 3300014325 Bacteria 856
49 Ga0157380_10607903 3300014326 Bacteria 1083
50 Ga0157377_10281891 3300014745 Bacteria 1090
51 Ga0157379_10201277 3300014968 Bacteria 1801
52 Ga0157379_10477325 3300014968 Bacteria 1154
53 Ga0163161_11954408 3300017792 Bacteria 522
54 Ga0206356_11021668 3300020070 Bacteria 5276
55 Ga0213872_10055962 3300021361 Bacteria 1787
56 Ga0213872_10263838 3300021361 Bacteria 722
57 Ga0207710_10041444 3300025900 Bacteria 2042
58 Ga0207680_10051326 3300025903 Bacteria 2466
59 Ga0207687_10851244 3300025927 Bacteria 779
60 Ga0207706_10000001 3300025933 Bacteria 423014
61 Ga0207669_10191022 3300025937 Bacteria 1477
62 Ga0207679_11095041 3300025945 Bacteria 731
63 Ga0207712_10405190 3300025961 Bacteria 1147
64 Ga0207658_10129912 3300025986 Bacteria 2022
65 Ga0207703_10301996 3300026035 Bacteria 1460
66 Ga0207703_10907980 3300026035 Bacteria 843
67 Ga0207678_11325379 3300026067 Bacteria 637
68 Ga0207641_10001869 3300026088 Bacteria 20215
69 Ga0207675_101362341 3300026118 Bacteria 730
70 Ga0207683_11001077 3300026121 Bacteria 776
71 Ga0207428_10351051 3300027907 Bacteria 1085
72 Ga0268266_10001743 3300028379 Bacteria 24876
73 Ga0268264_10000031 3300028381 Bacteria 409525
74 Ga0265336_10246839 3300028666 Bacteria 530
75 Ga0265338_10112135 3300028800 Bacteria 2194
76 Ga0265332_10392460 3300031238 Bacteria 573
77 Ga0265328_10107979 3300031239 Bacteria 1033
78 Ga0265325_10152186 3300031241 Bacteria 1093
79 Ga0265327_10015965 3300031251 Bacteria 4806
80 Ga0265327_10046520 3300031251 Bacteria 2295
81 Ga0265316_10036979 3300031344 Bacteria 3946
82 Ga0265314_10024682 3300031711 Bacteria 4552
83 Ga0395905_0233886 3300037471 Bacteria 1718
84 Ga0395905_1063915 3300037471 Bacteria 712
85 Ga0395901_0021632 3300038443 Bacteria 6589
86 Ga0395901_1312790 3300038443 Bacteria 685
87 Ga0436361_0482404 3300039447 Bacteria 5942
88 Ga0436361_0785159 3300039447 Bacteria 26623
89 Ga0436362_1283030 3300039453 Bacteria 827
90 Ga0451853_2744224 3300041512 Bacteria 553
91 Ga0466957_1274867 3300044842 Bacteria 533
92 Ga0495592_0229964 3300046454 Bacteria 1235
93 Ga0495591_057592 3300046458 Bacteria 1041
94 Ga0495629_0000428 3300046459 Bacteria 35056
95 Ga0495638_0021208 3300046460 Bacteria 4285
96 Ga0495582_0206417 3300046473 Bacteria 1123
97 Ga0495662_0063883 3300046476 Bacteria 1779
98 Ga0495583_0000500 3300046506 Bacteria 56753
99 Ga0495606_0000072 3300046507 Bacteria 173678
100 Ga0495606_0284438 3300046507 Bacteria 902
101 Ga0495608_0000056 3300046511 Bacteria 91026
102 Ga0495630_0000025 3300046517 Bacteria 152364
103 Ga0495637_0038121 3300046520 Bacteria 2082
104 Ga0495648_0001881 3300046524 Bacteria 20064
105 Ga0495652_0101016 3300046529 Bacteria 2339
106 Ga0495654_0136357 3300046530 Bacteria 1097
107 Ga0495611_0068910 3300046648 Bacteria 1615
108 Ga0495625_0001003 3300046660 Bacteria 37293
109 Ga0495625_0327048 3300046660 Bacteria 975
110 Ga0495657_0000023 3300046675 Bacteria 145522
111 Ga0495613_0000023 3300046689 Bacteria 153699
112 Ga0495624_0000241 3300046690 Bacteria 42989
113 Ga0495670_0153332 3300046691 Bacteria 1209
114 Ga0495589_0006288 3300046794 Bacteria 6272
115 Ga0495600_0005249 3300046809 Bacteria 7796
116 Ga0495660_0035349 3300046810 Bacteria 2792
117 Ga0495604_0000013 3300047317 Bacteria 234578
118 Ga0495676_0160227 3300047321 Bacteria 1593
119 Ga0495675_0000039 3300047444 Bacteria 91025
120 Ga0496100_0137799 3300048903 Bacteria 1726
121 Ga0496101_0932344 3300048904 Bacteria 683
122 Ga0496102_0348139 3300048905 Bacteria 1395
123 Ga0496104_0011315 3300048907 Bacteria 7987
124 Ga0496104_0176165 3300048907 Bacteria 2049
125 Ga0496104_1012359 3300048907 Bacteria 735
126 Ga0496105_0005390 3300048908 Bacteria 9703
127 Ga0496105_0043980 3300048908 Bacteria 3682
128 Ga0496107_0294455 3300048910 Bacteria 1208
129 Ga0496108_0220740 3300048911 Bacteria 1647
130 Ga0496109_0032800 3300048912 Bacteria 4671
131 Ga0496109_0311836 3300048912 Bacteria 1484
132 Ga0496109_0374856 3300048912 Bacteria 1344
133 Ga0496109_0467568 3300048912 Bacteria 1191
134 Ga0496109_1158836 3300048912 Bacteria 710
135 Ga0496110_0039949 3300048913 Bacteria 4088
136 Ga0496110_1296153 3300048913 Bacteria 638
137 Ga0496110_1498008 3300048913 Bacteria 584
138 Ga0496111_0352942 3300048914 Bacteria 1089
139 Ga0496112_0110334 3300048915 Bacteria 2721
140 Ga0496112_0147668 3300048915 Bacteria 2319
141 Ga0496112_0229276 3300048915 Bacteria 1812
142 Ga0496113_1042517 3300048916 Bacteria 643
143 Ga0496114_0614295 3300048917 Bacteria 958
144 Ga0495678_004984 3300049459 Bacteria 7481
145 Ga0495682_0011102 3300049460 Bacteria 3471
146 Ga0501039_0424708 3300049575 Bacteria 1044
147 Ga0501039_1013490 3300049575 Bacteria 645
148 Ga0501040_0049268 3300049576 Bacteria 2880
149 Ga0501042_0126822 3300049578 Bacteria 1838
150 Ga0501071_0637386 3300049587 Bacteria 820
151 Ga0501072_0158021 3300049588 Bacteria 1808
152 Ga0501074_1050616 3300049590 Bacteria 572
153 Ga0501076_0021267 3300049592 Bacteria 4976
154 Ga0501076_0530161 3300049592 Bacteria 971
155 Ga0501079_0390069 3300049741 Bacteria 1092
156 Ga0501045_0146129 3300049824 Bacteria 1759
157 Ga0501045_1042106 3300049824 Bacteria 599
158 nmdc:mga00v17_455265_c1 3300050491 Bacteria 830
159 nmdc:mga0yw44_68379_c1 3300050492 Bacteria 2197
160 nmdc:mga0qj67_110604_c1 3300050509 Bacteria 2218
161 nmdc:mga0qj67_177541_c1 3300050509 Bacteria 1730
162 nmdc:mga0qj67_414289_c1 3300050509 Bacteria 1087
163 nmdc:mga0qj67_457285_c1 3300050509 Bacteria 1028
164 nmdc:mga0n895_473672_c1 3300050512 Bacteria 1263
165 Ga0495601_0000070 3300053077 Bacteria 56243
166 Ga0495601_0014155 3300053077 Bacteria 4806
167 Ga0495612_0029123 3300053078 Bacteria 2223
168 Ga0495595_0000029 3300053084 Bacteria 91026
169 Ga0495619_0000029 3300053085 Bacteria 158166
170 Ga0500555_000587 3300053103 Bacteria 14288
171 Ga0500586_067402 3300053145 Bacteria 1250
172 Ga0501084_0142111 3300054114 Bacteria 2021
173 Ga0501082_1589612 3300060353 Bacteria 571
174 Ga0530510_0004030 3300061734 Bacteria 10141

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049592 Ga0501076_0021267 Ga0501076_0021267_3276_3686 112
2 3300005339 Ga0070660_100119418 Ga0070660_1001194184 120
3 3300006038 Ga0075365_10573930 Ga0075365_105739301 120
4 3300050492 nmdc:mga0yw44_68379_c1 nmdc:mga0yw44_68379_c1_66_446 120
5 3300053078 Ga0495612_0029123 Ga0495612_0029123_1359_1748 120
6 3300005367 Ga0070667_100289618 Ga0070667_1002896183 121
7 3300005985 Ga0081539_10260837 Ga0081539_102608371 121
8 3300006237 Ga0097621_100506466 Ga0097621_1005064662 121
9 3300006358 Ga0068871_100540862 Ga0068871_1005408621 121
10 3300013297 Ga0157378_10045312 Ga0157378_100453122 121
11 3300013306 Ga0163162_12018869 Ga0163162_120188691 121
12 3300014325 Ga0163163_10046987 Ga0163163_100469875 121
13 3300014745 Ga0157377_10281891 Ga0157377_102818913 121
14 3300025900 Ga0207710_10041444 Ga0207710_100414442 121
15 3300025937 Ga0207669_10191022 Ga0207669_101910222 121
16 3300026067 Ga0207678_11325379 Ga0207678_113253791 121
17 3300041512 Ga0451853_2744224 Ga0451853_2744224_110_499 121
18 3300046454 Ga0495592_0229964 Ga0495592_0229964_710_1078 121
19 3300046459 Ga0495629_0000428 Ga0495629_0000428_18245_18637 121
20 3300046476 Ga0495662_0063883 Ga0495662_0063883_245_610 121
21 3300046507 Ga0495606_0000072 Ga0495606_0000072_90815_91207 121
22 3300046517 Ga0495630_0000025 Ga0495630_0000025_66775_67152 121
23 3300046529 Ga0495652_0101016 Ga0495652_0101016_741_1139 121
24 3300046689 Ga0495613_0000023 Ga0495613_0000023_89468_89833 121
25 3300046690 Ga0495624_0000241 Ga0495624_0000241_23492_23869 121
26 3300046809 Ga0495600_0005249 Ga0495600_0005249_6709_7074 121
27 3300047317 Ga0495604_0000013 Ga0495604_0000013_138524_138889 121
28 3300048912 Ga0496109_0374856 Ga0496109_0374856_552_920 121
29 3300048915 Ga0496112_0147668 Ga0496112_0147668_1758_2126 121
30 3300060353 Ga0501082_1589612 Ga0501082_1589612_76_456 121
31 3300005981 Ga0081538_10033360 Ga0081538_100333602 122
32 3300013306 Ga0163162_11390385 Ga0163162_113903852 122
33 3300020070 Ga0206356_11021668 Ga0206356_110216684 122
34 3300046511 Ga0495608_0000056 Ga0495608_0000056_17831_18214 122
35 3300046675 Ga0495657_0000023 Ga0495657_0000023_72813_73196 122
36 3300046691 Ga0495670_0153332 Ga0495670_0153332_768_1157 122
37 3300047321 Ga0495676_0160227 Ga0495676_0160227_710_1096 122
38 3300047444 Ga0495675_0000039 Ga0495675_0000039_17830_18213 122
39 3300048907 Ga0496104_0176165 Ga0496104_0176165_571_939 122
40 3300048908 Ga0496105_0005390 Ga0496105_0005390_1012_1380 122
41 3300048912 Ga0496109_0311836 Ga0496109_0311836_870_1241 122
42 3300053077 Ga0495601_0000070 Ga0495601_0000070_49878_50246 122
43 3300053084 Ga0495595_0000029 Ga0495595_0000029_17831_18214 122
44 3300053085 Ga0495619_0000029 Ga0495619_0000029_85465_85848 122
45 3300005564 Ga0070664_100963711 Ga0070664_1009637112 123
46 3300025945 Ga0207679_11095041 Ga0207679_110950412 123
47 3300044842 Ga0466957_1274867 Ga0466957_1274867_83_472 123
48 3300046660 Ga0495625_0001003 Ga0495625_0001003_15309_15686 123
49 3300048903 Ga0496100_0137799 Ga0496100_0137799_546_920 123
50 3300048904 Ga0496101_0932344 Ga0496101_0932344_169_543 123
51 3300048905 Ga0496102_0348139 Ga0496102_0348139_363_737 123
52 3300048907 Ga0496104_1012359 Ga0496104_1012359_12_386 123
53 3300048910 Ga0496107_0294455 Ga0496107_0294455_388_762 123
54 3300048911 Ga0496108_0220740 Ga0496108_0220740_967_1341 123
55 3300048912 Ga0496109_0032800 Ga0496109_0032800_1528_1902 123
56 3300048912 Ga0496109_1158836 Ga0496109_1158836_273_644 123
57 3300048913 Ga0496110_0039949 Ga0496110_0039949_2792_3166 123
58 3300048913 Ga0496110_1296153 Ga0496110_1296153_19_390 123
59 3300048914 Ga0496111_0352942 Ga0496111_0352942_240_632 123
60 3300048915 Ga0496112_0229276 Ga0496112_0229276_146_517 123
61 3300048916 Ga0496113_1042517 Ga0496113_1042517_135_527 123
62 3300048917 Ga0496114_0614295 Ga0496114_0614295_167_541 123
63 3300002459 JGI24751J29686_10014814 JGI24751J29686_100148143 124
64 3300005329 Ga0070683_100384343 Ga0070683_1003843432 124
65 3300005335 Ga0070666_10070630 Ga0070666_100706304 124
66 3300005340 Ga0070689_100351749 Ga0070689_1003517492 124
67 3300005343 Ga0070687_100366940 Ga0070687_1003669401 124
68 3300005347 Ga0070668_100230670 Ga0070668_1002306702 124
69 3300005347 Ga0070668_100391385 Ga0070668_1003913852 124
70 3300005353 Ga0070669_100611278 Ga0070669_1006112782 124
71 3300005367 Ga0070667_100057295 Ga0070667_1000572954 124
72 3300005436 Ga0070713_102443921 Ga0070713_1024439211 124
73 3300005440 Ga0070705_100368687 Ga0070705_1003686872 124
74 3300005444 Ga0070694_100060506 Ga0070694_1000605063 124
75 3300005457 Ga0070662_100000002 Ga0070662_10000000226 124
76 3300005459 Ga0068867_102340980 Ga0068867_1023409801 124
77 3300005467 Ga0070706_100898969 Ga0070706_1008989691 124
78 3300005471 Ga0070698_100000108 Ga0070698_10000010856 124
79 3300005548 Ga0070665_100001319 Ga0070665_10000131919 124
80 3300005549 Ga0070704_100716436 Ga0070704_1007164361 124
81 3300005549 Ga0070704_101137374 Ga0070704_1011373742 124
82 3300005841 Ga0068863_100000838 Ga0068863_10000083812 124
83 3300005842 Ga0068858_100066329 Ga0068858_1000663292 124
84 3300005843 Ga0068860_100000035 Ga0068860_10000003527 124
85 3300006038 Ga0075365_11162505 Ga0075365_111625051 124
86 3300006846 Ga0075430_100053696 Ga0075430_1000536962 124
87 3300006846 Ga0075430_100254627 Ga0075430_1002546273 124
88 3300006871 Ga0075434_100382147 Ga0075434_1003821472 124
89 3300009093 Ga0105240_10463816 Ga0105240_104638162 124
90 3300009098 Ga0105245_10845648 Ga0105245_108456481 124
91 3300009098 Ga0105245_11524204 Ga0105245_115242041 124
92 3300009176 Ga0105242_10697871 Ga0105242_106978711 124
93 3300011119 Ga0105246_10224487 Ga0105246_102244872 124
94 3300011119 Ga0105246_11107479 Ga0105246_111074791 124
95 3300011119 Ga0105246_11655445 Ga0105246_116554451 124
96 3300013104 Ga0157370_11544064 Ga0157370_115440641 124
97 3300014325 Ga0163163_10720686 Ga0163163_107206862 124
98 3300014325 Ga0163163_11103975 Ga0163163_111039751 124
99 3300014326 Ga0157380_10607903 Ga0157380_106079032 124
100 3300014968 Ga0157379_10201277 Ga0157379_102012774 124
101 3300014968 Ga0157379_10477325 Ga0157379_104773252 124
102 3300017792 Ga0163161_11954408 Ga0163161_119544081 124
103 3300021361 Ga0213872_10055962 Ga0213872_100559623 124
104 3300021361 Ga0213872_10263838 Ga0213872_102638381 124
105 3300025903 Ga0207680_10051326 Ga0207680_100513262 124
106 3300025927 Ga0207687_10851244 Ga0207687_108512442 124
107 3300025933 Ga0207706_10000001 Ga0207706_10000001206 124
108 3300025961 Ga0207712_10405190 Ga0207712_104051901 124
109 3300025986 Ga0207658_10129912 Ga0207658_101299123 124
110 3300026035 Ga0207703_10301996 Ga0207703_103019963 124
111 3300026035 Ga0207703_10907980 Ga0207703_109079801 124
112 3300026088 Ga0207641_10001869 Ga0207641_1000186912 124
113 3300026118 Ga0207675_101362341 Ga0207675_1013623412 124
114 3300026121 Ga0207683_11001077 Ga0207683_110010771 124
115 3300027907 Ga0207428_10351051 Ga0207428_103510512 124
116 3300028379 Ga0268266_10001743 Ga0268266_1000174321 124
117 3300028381 Ga0268264_10000031 Ga0268264_10000031376 124
118 3300028666 Ga0265336_10246839 Ga0265336_102468391 124
119 3300028800 Ga0265338_10112135 Ga0265338_101121352 124
120 3300031238 Ga0265332_10392460 Ga0265332_103924601 124
121 3300031239 Ga0265328_10107979 Ga0265328_101079792 124
122 3300031241 Ga0265325_10152186 Ga0265325_101521862 124
123 3300031251 Ga0265327_10015965 Ga0265327_100159652 124
124 3300031251 Ga0265327_10046520 Ga0265327_100465202 124
125 3300031344 Ga0265316_10036979 Ga0265316_100369791 124
126 3300031711 Ga0265314_10024682 Ga0265314_100246822 124
127 3300037471 Ga0395905_0233886 Ga0395905_0233886_1129_1530 124
128 3300037471 Ga0395905_1063915 Ga0395905_1063915_104_499 124
129 3300038443 Ga0395901_0021632 Ga0395901_0021632_4933_5331 124
130 3300038443 Ga0395901_1312790 Ga0395901_1312790_86_487 124
131 3300039447 Ga0436361_0482404 Ga0436361_0482404_2009_2425 124
132 3300039447 Ga0436361_0785159 Ga0436361_0785159_22791_23213 124
133 3300039453 Ga0436362_1283030 Ga0436362_1283030_137_538 124
134 3300046458 Ga0495591_057592 Ga0495591_057592_191_595 124
135 3300046460 Ga0495638_0021208 Ga0495638_0021208_2195_2593 124
136 3300046473 Ga0495582_0206417 Ga0495582_0206417_393_818 124
137 3300046506 Ga0495583_0000500 Ga0495583_0000500_12203_12601 124
138 3300046507 Ga0495606_0284438 Ga0495606_0284438_20_424 124
139 3300046520 Ga0495637_0038121 Ga0495637_0038121_160_564 124
140 3300046524 Ga0495648_0001881 Ga0495648_0001881_1158_1562 124
141 3300046530 Ga0495654_0136357 Ga0495654_0136357_258_662 124
142 3300046648 Ga0495611_0068910 Ga0495611_0068910_164_568 124
143 3300046660 Ga0495625_0327048 Ga0495625_0327048_425_829 124
144 3300046794 Ga0495589_0006288 Ga0495589_0006288_1227_1631 124
145 3300046810 Ga0495660_0035349 Ga0495660_0035349_1456_1860 124
146 3300048907 Ga0496104_0011315 Ga0496104_0011315_4001_4381 124
147 3300048908 Ga0496105_0043980 Ga0496105_0043980_2418_2798 124
148 3300048912 Ga0496109_0467568 Ga0496109_0467568_174_581 124
149 3300048913 Ga0496110_1498008 Ga0496110_1498008_21_419 124
150 3300048915 Ga0496112_0110334 Ga0496112_0110334_2147_2584 124
151 3300049459 Ga0495678_004984 Ga0495678_004984_3039_3437 124
152 3300049460 Ga0495682_0011102 Ga0495682_0011102_1927_2325 124
153 3300049575 Ga0501039_0424708 Ga0501039_0424708_486_896 124
154 3300049575 Ga0501039_1013490 Ga0501039_1013490_40_438 124
155 3300049576 Ga0501040_0049268 Ga0501040_0049268_913_1323 124
156 3300049578 Ga0501042_0126822 Ga0501042_0126822_172_582 124
157 3300049587 Ga0501071_0637386 Ga0501071_0637386_296_697 124
158 3300049588 Ga0501072_0158021 Ga0501072_0158021_28_438 124
159 3300049590 Ga0501074_1050616 Ga0501074_1050616_118_528 124
160 3300049592 Ga0501076_0530161 Ga0501076_0530161_487_942 124
161 3300049741 Ga0501079_0390069 Ga0501079_0390069_102_515 124
162 3300049824 Ga0501045_0146129 Ga0501045_0146129_1218_1628 124
163 3300049824 Ga0501045_1042106 Ga0501045_1042106_79_465 124
164 3300050491 nmdc:mga00v17_455265_c1 nmdc:mga00v17_455265_c1_65_451 124
165 3300050509 nmdc:mga0qj67_110604_c1 nmdc:mga0qj67_110604_c1_1582_1965 124
166 3300050509 nmdc:mga0qj67_177541_c1 nmdc:mga0qj67_177541_c1_869_1252 124
167 3300050509 nmdc:mga0qj67_414289_c1 nmdc:mga0qj67_414289_c1_157_540 124
168 3300050509 nmdc:mga0qj67_457285_c1 nmdc:mga0qj67_457285_c1_122_505 124
169 3300050512 nmdc:mga0n895_473672_c1 nmdc:mga0n895_473672_c1_67_450 124
170 3300053077 Ga0495601_0014155 Ga0495601_0014155_2198_2578 124
171 3300053103 Ga0500555_000587 Ga0500555_000587_5443_5841 124
172 3300053145 Ga0500586_067402 Ga0500586_067402_702_1106 124
173 3300054114 Ga0501084_0142111 Ga0501084_0142111_406_816 124
174 3300061734 Ga0530510_0004030 Ga0530510_0004030_8995_9393 124

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08818

DUF1801

Domain of unknown function (DU1801)

27

123

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.7592 8 120
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.6676 2 124
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.6631 2 124
3imo-assembly1.cif.gz_C structure from the mobile metagenome of vibrio cholerae. integron cassette protein vch_cass14 0.6268 6 114
8p1x-assembly1.cif.gz_AAA tarm(se)_g117r-udp-glucose 0.6008 25 101
ID Description Score Start End Superfamily
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7754 8 120 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.746 8 120 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7216 8 124 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7057 8 124 3.90.1150.200
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6838 25 122 3.90.1150.30
ID Description Score Start End GO Terms
AF-A0A1H5KFY4-F1-model_v4 YdhG-like domain-containing protein 1.002 1 123
AF-A0A1E4DJ85-F1-model_v4 deleted 1.001 1 123
AF-A0A561I0U0-F1-model_v4 deleted 1.001 1 121
AF-A0A2W6BZP3-F1-model_v4 YdhG-like domain-containing protein 1.001 2 121
AF-A0A1A6B7E1-F1-model_v4 YdhG-like domain-containing protein 0.9999 18 123

Feature Viewer

pLDDT pTM Quality
92.07 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map