F265334

General Info

Members Datasets Scaffolds Average Seq Length
174 129 348 473

Family's Representative Sequence

Representative Sequence 3300049583|Ga0501067_0034794|Ga0501067_0034794_418_1959
Length 513
Sequence VTDETHPEQTSNLPSTPTDDSLRQLSEYIEGARWFGGKGRSARVTGVRRLGVISEESPRVVVDLAEVSYDDGGMDLYQVPLSMYTDPEHRLDHAFVGWWEDPDVGWTHAYDAIHDREAMAAYLRAFAYPPDGPLEFRRLPGEELDPTAPSTPFTGEQSNSSVAFGEQALLKLFRRITPGTNPDIEIHEQLTLAGSENVAALLGWIECDAVGGFEPFETAHPSPPQEPTLAERPPXXPERLQLGMLQQFLRTASDGWELALTSVRNLFAEADLYADEVGGDFAGEAQRLGEAVADVHRLLAGHFPTSERTAGDHAELAKAMAERLEAALDVVPELAEHAPGLRDLFAAVGSIESGQIQRVHGDLHLGQTLRTAKGWKIVDFEGEPAKPLADRVLPDSPWRDVAGMLRSFDYAPRVAAMTASATGDEGDEQRAYRAAEWSARNQSAFLEAYAGRELTGDEQTLLAAYVADKAVYECVYEARNRPSWLSIPLAAFGPSIPGLTMPALTDSVREEHR

Samples

Sample ID Description Type Environment
1 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
66 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
67 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
68 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
69 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
70 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
71 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
72 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
73 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
74 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
75 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
76 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
77 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
78 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
79 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
80 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
81 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
82 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
83 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
84 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
85 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
86 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
87 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
88 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
89 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
90 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
91 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
92 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
102 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
103 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
104 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
105 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
106 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
107 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
108 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
109 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
110 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
111 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
112 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
113 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
114 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
115 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
116 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
117 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
118 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
119 2643221546 Microbacterium sp. Root53 Isolate Unclassified
120 2643221576 Nocardioides sp. Root614 Isolate Unclassified
121 2643221590 Nocardioides sp. Root682 Isolate Unclassified
122 2643221604 Nocardioides sp. Root190 Isolate Unclassified
123 2643221615 Nocardioides sp. Root224 Isolate Unclassified
124 2643221617 Nocardioides sp. Root79 Isolate Unclassified
125 2643221620 Nocardioides sp. Root240 Isolate Unclassified
126 2643221641 Nocardioides sp. Root122 Isolate Unclassified
127 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
128 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
129 2857481737 Nocardioides sp. R-74106 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.68
Metatranscriptomes 0
Isolates 6.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.17
Nodule 0
Rhizoplane 12.07
Rhizosphere 76.44
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501067_0034794 3300049583 Bacteria 2796
2 LJQas_1000285 3300000549 Bacteria 9112
3 Ga0070683_100004137 3300005329 Bacteria 11889
4 Ga0070683_100031397 3300005329 Bacteria 4829
5 Ga0070683_100053122 3300005329 Bacteria 3755
6 Ga0070682_100009823 3300005337 Bacteria 5417
7 Ga0070660_100052810 3300005339 Bacteria 3134
8 Ga0070692_10019097 3300005345 Bacteria 3305
9 Ga0070673_100042669 3300005364 Bacteria 3499
10 Ga0070659_100003301 3300005366 Bacteria 11491
11 Ga0070659_100080990 3300005366 Bacteria 2592
12 Ga0070659_100102016 3300005366 Bacteria 2309
13 Ga0070701_10000427 3300005438 Bacteria 14343
14 Ga0070700_100016939 3300005441 Bacteria 4159
15 Ga0068867_100015755 3300005459 Bacteria 5365
16 Ga0070706_100003956 3300005467 Bacteria 14432
17 Ga0070698_100102241 3300005471 Bacteria 2837
18 Ga0070684_100021961 3300005535 Bacteria 5317
19 Ga0070672_100002030 3300005543 Bacteria 12732
20 Ga0070665_100010619 3300005548 Bacteria 9323
21 Ga0068857_100012986 3300005577 Bacteria 7258
22 Ga0070702_100036857 3300005615 Bacteria 2713
23 Ga0068852_100094001 3300005616 Bacteria 2688
24 Ga0068864_100022778 3300005618 Bacteria 5254
25 Ga0068864_100233404 3300005618 Bacteria 1702
26 Ga0068858_100129621 3300005842 Bacteria 2364
27 Ga0081455_10000056 3300005937 Bacteria 120354
28 Ga0075365_10003924 3300006038 Bacteria 7786
29 Ga0075365_10051300 3300006038 Bacteria 2724
30 Ga0075363_100081617 3300006048 Bacteria 1769
31 Ga0075364_10097547 3300006051 Bacteria 1955
32 Ga0075362_10011989 3300006177 Bacteria 3429
33 Ga0075428_100119207 3300006844 Bacteria 2874
34 Ga0075436_100009887 3300006914 Bacteria 6524
35 Ga0111539_10121321 3300009094 Bacteria 3063
36 Ga0105245_10032327 3300009098 Bacteria 4632
37 Ga0105243_10005849 3300009148 Bacteria 9534
38 Ga0105243_10010007 3300009148 Bacteria 7209
39 Ga0105243_10060712 3300009148 Bacteria 3020
40 Ga0105243_10061921 3300009148 Bacteria 2994
41 Ga0105248_10047260 3300009177 Bacteria 4827
42 Ga0105248_10064011 3300009177 Bacteria 4128
43 Ga0105249_10020032 3300009553 Bacteria 5974
44 Ga0105239_10014091 3300010375 Bacteria 8875
45 Ga0105239_10104865 3300010375 Bacteria 3130
46 Ga0105246_10007913 3300011119 Bacteria 6523
47 Ga0157374_10153549 3300013296 Bacteria 2240
48 Ga0163162_10031987 3300013306 Bacteria 5222
49 Ga0157372_10002981 3300013307 Bacteria 18239
50 Ga0157375_10041026 3300013308 Bacteria 4466
51 Ga0163163_10097480 3300014325 Bacteria 2960
52 Ga0157380_10073643 3300014326 Bacteria 2770
53 Ga0157377_10010992 3300014745 Bacteria 4501
54 Ga0157376_10304573 3300014969 Bacteria 1510
55 Ga0207688_10025760 3300025901 Bacteria 3233
56 Ga0207688_10043483 3300025901 Bacteria 2502
57 Ga0207647_10004061 3300025904 Bacteria 10894
58 Ga0207647_10053523 3300025904 Bacteria 2487
59 Ga0207643_10000396 3300025908 Bacteria 29067
60 Ga0207662_10051271 3300025918 Bacteria 2455
61 Ga0207657_10007635 3300025919 Bacteria 11068
62 Ga0207657_10022531 3300025919 Bacteria 5889
63 Ga0207687_10008634 3300025927 Bacteria 6661
64 Ga0207700_10246481 3300025928 Bacteria 1525
65 Ga0207690_10030616 3300025932 Bacteria 3435
66 Ga0207690_10061800 3300025932 Bacteria 2548
67 Ga0207690_10083711 3300025932 Bacteria 2234
68 Ga0207709_10005682 3300025935 Bacteria 7044
69 Ga0207669_10143414 3300025937 Bacteria 1662
70 Ga0207691_10003397 3300025940 Bacteria 15481
71 Ga0207661_10014760 3300025944 Bacteria 5731
72 Ga0207661_10128232 3300025944 Bacteria 2169
73 Ga0207651_10190298 3300025960 Bacteria 1636
74 Ga0207678_10091437 3300026067 Bacteria 2601
75 Ga0207708_10000180 3300026075 Bacteria 49555
76 Ga0207648_10033925 3300026089 Bacteria 4501
77 Ga0207674_10028202 3300026116 Bacteria 5929
78 Ga0207674_10336397 3300026116 Bacteria 1460
79 Ga0207675_100038319 3300026118 Bacteria 4473
80 Ga0207675_100063674 3300026118 Bacteria 3446
81 Ga0207683_10025589 3300026121 Bacteria 5092
82 Ga0207683_10136502 3300026121 Bacteria 2208
83 Ga0207698_10148667 3300026142 Bacteria 2030
84 Ga0268266_10002826 3300028379 Bacteria 18108
85 Ga0307405_10020925 3300031731 Bacteria 3667
86 Ga0307412_10023758 3300031911 Bacteria 3777
87 Ga0307409_100031488 3300031995 Bacteria 3829
88 Ga0307409_100043398 3300031995 Bacteria 3376
89 Ga0307416_100000837 3300032002 Bacteria 16183
90 Ga0307415_100000288 3300032126 Bacteria 21803
91 Ga0307415_100065571 3300032126 Bacteria 2531
92 Ga0395900_0205434 3300037418 Bacteria 1991
93 Ga0395898_0054570 3300037466 Bacteria 3899
94 Ga0395901_0059980 3300038443 Bacteria 3958
95 Ga0466965_0025224 3300044683 Bacteria 2878
96 Ga0466961_0011921 3300044693 Bacteria 5557
97 Ga0466961_0039091 3300044693 Bacteria 3042
98 Ga0466963_0075647 3300044694 Bacteria 2273
99 Ga0466970_0014570 3300044765 Bacteria 4038
100 Ga0466970_0091941 3300044765 Bacteria 1647
101 Ga0466957_0004987 3300044842 Bacteria 7425
102 Ga0466957_0045196 3300044842 Bacteria 2671
103 Ga0466958_0040631 3300045836 Bacteria 2795
104 Ga0466967_0021513 3300045976 Bacteria 5242
105 Ga0466967_0027800 3300045976 Bacteria 4710
106 Ga0466967_0034388 3300045976 Bacteria 4301
107 Ga0466967_0050350 3300045976 Bacteria 3647
108 Ga0496100_0078854 3300048903 Bacteria 2218
109 Ga0496102_0038411 3300048905 Bacteria 4320
110 Ga0496102_0083872 3300048905 Bacteria 2940
111 Ga0496102_0092981 3300048905 Bacteria 2794
112 Ga0496104_0043633 3300048907 Bacteria 4211
113 Ga0496105_0004622 3300048908 Bacteria 10380
114 Ga0496106_0025535 3300048909 Bacteria 4398
115 Ga0496107_0021927 3300048910 Bacteria 4512
116 Ga0496108_0044435 3300048911 Bacteria 3709
117 Ga0496108_0247237 3300048911 Bacteria 1551
118 Ga0496109_0026294 3300048912 Bacteria 5189
119 Ga0496109_0039638 3300048912 Bacteria 4264
120 Ga0496109_0046630 3300048912 Bacteria 3937
121 Ga0496111_0024293 3300048914 Bacteria 4265
122 Ga0496111_0106983 3300048914 Bacteria 2059
123 Ga0496113_0100309 3300048916 Bacteria 2243
124 Ga0496113_0103468 3300048916 Bacteria 2209
125 Ga0496114_0000563 3300048917 Bacteria 27517
126 Ga0496114_0004593 3300048917 Bacteria 10723
127 Ga0496114_0070744 3300048917 Bacteria 2931
128 Ga0496115_0004917 3300048918 Bacteria 9704
129 Ga0501031_0001799 3300049568 Bacteria 13460
130 Ga0501033_0092850 3300049570 Bacteria 2207
131 Ga0501036_0060355 3300049572 Bacteria 3212
132 Ga0501038_0023198 3300049574 Bacteria 5551
133 Ga0501040_0000851 3300049576 Bacteria 19154
134 Ga0501040_0056652 3300049576 Bacteria 2690
135 Ga0501041_0008655 3300049577 Bacteria 5996
136 Ga0501042_0006835 3300049578 Bacteria 7441
137 Ga0501046_0027575 3300049580 Bacteria 4633
138 Ga0501048_0030075 3300049582 Bacteria 3933
139 Ga0501067_0053297 3300049583 Bacteria 2241
140 Ga0501068_0004759 3300049584 Bacteria 7384
141 Ga0501069_0024292 3300049585 Bacteria 3305
142 Ga0501070_0003970 3300049586 Bacteria 12729
143 Ga0501070_0012911 3300049586 Bacteria 7040
144 Ga0501070_0061259 3300049586 Bacteria 3118
145 Ga0501072_0015999 3300049588 Bacteria 5752
146 Ga0501073_0062986 3300049589 Bacteria 2586
147 Ga0501074_0000499 3300049590 Bacteria 24035
148 Ga0501074_0013257 3300049590 Bacteria 5992
149 Ga0501074_0022921 3300049590 Bacteria 4541
150 Ga0501076_0007365 3300049592 Bacteria 8005
151 Ga0501079_0020483 3300049741 Bacteria 5057
152 Ga0501083_0023860 3300049744 Bacteria 4242
153 Ga0501045_0066001 3300049824 Bacteria 2657
154 nmdc:mga03683_21000_c1 3300050489 Bacteria 2511
155 nmdc:mga03n38_50240_c1 3300050490 Bacteria 1857
156 nmdc:mga0yw44_2413_c1 3300050492 Bacteria 7956
157 nmdc:mga08y16_63126_c1 3300050511 Bacteria 3868
158 Ga0495619_0024494 3300053085 Bacteria 3871
159 Ga0500644_0000343 3300053088 Bacteria 23461
160 Ga0466962_0039437 3300061719 Bacteria 2262
161 Ga0466962_0041572 3300061719 Bacteria 2199
162 Ga0530510_0014825 3300061734 Bacteria 5504
163 Ga0530510_0129022 3300061734 Bacteria 1860
164 2643751921 2643221546 Bacteria 2910897
165 2643893050 2643221576 Bacteria 5214352
166 2643961891 2643221590 Bacteria 5214697
167 2644034183 2643221604 Bacteria 5014917
168 2644090317 2643221615 Bacteria 5487866
169 2644102443 2643221617 Bacteria 5139111
170 2644118105 2643221620 Bacteria 5134593
171 2644230664 2643221641 Bacteria 4490190
172 2644320163 2643221657 Bacteria 5490246
173 2855389773 2855386786 Bacteria 4752232
174 2857481926 2857481737 Bacteria 4761446
175 Ga0501067_0034794
176 LJQas_1000285
177 Ga0070683_100004137
178 Ga0070683_100031397
179 Ga0070683_100053122
180 Ga0070682_100009823
181 Ga0070660_100052810
182 Ga0070692_10019097
183 Ga0070673_100042669
184 Ga0070659_100003301
185 Ga0070659_100080990
186 Ga0070659_100102016
187 Ga0070701_10000427
188 Ga0070700_100016939
189 Ga0068867_100015755
190 Ga0070706_100003956
191 Ga0070698_100102241
192 Ga0070684_100021961
193 Ga0070672_100002030
194 Ga0070665_100010619
195 Ga0068857_100012986
196 Ga0070702_100036857
197 Ga0068852_100094001
198 Ga0068864_100022778
199 Ga0068864_100233404
200 Ga0068858_100129621
201 Ga0081455_10000056
202 Ga0075365_10003924
203 Ga0075365_10051300
204 Ga0075363_100081617
205 Ga0075364_10097547
206 Ga0075362_10011989
207 Ga0075428_100119207
208 Ga0075436_100009887
209 Ga0111539_10121321
210 Ga0105245_10032327
211 Ga0105243_10005849
212 Ga0105243_10010007
213 Ga0105243_10060712
214 Ga0105243_10061921
215 Ga0105248_10047260
216 Ga0105248_10064011
217 Ga0105249_10020032
218 Ga0105239_10014091
219 Ga0105239_10104865
220 Ga0105246_10007913
221 Ga0157374_10153549
222 Ga0163162_10031987
223 Ga0157372_10002981
224 Ga0157375_10041026
225 Ga0163163_10097480
226 Ga0157380_10073643
227 Ga0157377_10010992
228 Ga0157376_10304573
229 Ga0207688_10025760
230 Ga0207688_10043483
231 Ga0207647_10004061
232 Ga0207647_10053523
233 Ga0207643_10000396
234 Ga0207662_10051271
235 Ga0207657_10007635
236 Ga0207657_10022531
237 Ga0207687_10008634
238 Ga0207700_10246481
239 Ga0207690_10030616
240 Ga0207690_10061800
241 Ga0207690_10083711
242 Ga0207709_10005682
243 Ga0207669_10143414
244 Ga0207691_10003397
245 Ga0207661_10014760
246 Ga0207661_10128232
247 Ga0207651_10190298
248 Ga0207678_10091437
249 Ga0207708_10000180
250 Ga0207648_10033925
251 Ga0207674_10028202
252 Ga0207674_10336397
253 Ga0207675_100038319
254 Ga0207675_100063674
255 Ga0207683_10025589
256 Ga0207683_10136502
257 Ga0207698_10148667
258 Ga0268266_10002826
259 Ga0307405_10020925
260 Ga0307412_10023758
261 Ga0307409_100031488
262 Ga0307409_100043398
263 Ga0307416_100000837
264 Ga0307415_100000288
265 Ga0307415_100065571
266 Ga0395900_0205434
267 Ga0395898_0054570
268 Ga0395901_0059980
269 Ga0466965_0025224
270 Ga0466961_0011921
271 Ga0466961_0039091
272 Ga0466963_0075647
273 Ga0466970_0014570
274 Ga0466970_0091941
275 Ga0466957_0004987
276 Ga0466957_0045196
277 Ga0466958_0040631
278 Ga0466967_0021513
279 Ga0466967_0027800
280 Ga0466967_0034388
281 Ga0466967_0050350
282 Ga0496100_0078854
283 Ga0496102_0038411
284 Ga0496102_0083872
285 Ga0496102_0092981
286 Ga0496104_0043633
287 Ga0496105_0004622
288 Ga0496106_0025535
289 Ga0496107_0021927
290 Ga0496108_0044435
291 Ga0496108_0247237
292 Ga0496109_0026294
293 Ga0496109_0039638
294 Ga0496109_0046630
295 Ga0496111_0024293
296 Ga0496111_0106983
297 Ga0496113_0100309
298 Ga0496113_0103468
299 Ga0496114_0000563
300 Ga0496114_0004593
301 Ga0496114_0070744
302 Ga0496115_0004917
303 Ga0501031_0001799
304 Ga0501033_0092850
305 Ga0501036_0060355
306 Ga0501038_0023198
307 Ga0501040_0000851
308 Ga0501040_0056652
309 Ga0501041_0008655
310 Ga0501042_0006835
311 Ga0501046_0027575
312 Ga0501048_0030075
313 Ga0501067_0053297
314 Ga0501068_0004759
315 Ga0501069_0024292
316 Ga0501070_0003970
317 Ga0501070_0012911
318 Ga0501070_0061259
319 Ga0501072_0015999
320 Ga0501073_0062986
321 Ga0501074_0000499
322 Ga0501074_0013257
323 Ga0501074_0022921
324 Ga0501076_0007365
325 Ga0501079_0020483
326 Ga0501083_0023860
327 Ga0501045_0066001
328 nmdc:mga03683_21000_c1
329 nmdc:mga03n38_50240_c1
330 nmdc:mga0yw44_2413_c1
331 nmdc:mga08y16_63126_c1
332 Ga0495619_0024494
333 Ga0500644_0000343
334 Ga0466962_0039437
335 Ga0466962_0041572
336 Ga0530510_0014825
337 Ga0530510_0129022
338 2643751921
339 2643893050
340 2643961891
341 2644034183
342 2644090317
343 2644102443
344 2644118105
345 2644230664
346 2644320163
347 2855389773
348 2857481926

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18085

Mak_N_cap

Maltokinase N-terminal cap domain

28

115

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jy7-assembly2.cif.gz_N complex of mycobacterium smegmatis trehalose synthase with maltokinase 0.9298 102 462
5jy7-assembly2.cif.gz_N complex of mycobacterium smegmatis trehalose synthase with maltokinase 0.9247 102 462
5jy7-assembly2.cif.gz_P complex of mycobacterium smegmatis trehalose synthase with maltokinase 0.9207 220 462
5jy7-assembly2.cif.gz_M complex of mycobacterium smegmatis trehalose synthase with maltokinase 0.9068 9 462
5jy7-assembly1.cif.gz_I complex of mycobacterium smegmatis trehalose synthase with maltokinase 0.906 9 462
ID Description Score Start End Superfamily
af_O07177_216_455_3.90.1200.10 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.9243 220 466 3.90.1200.10
af_O07177_216_455_3.90.1200.10 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.9131 220 466 3.90.1200.10
af_O07177_97_215_3.30.1010.10 Alpha Beta;2-Layer Sandwich;Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4;Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 0.854 107 216 3.30.1010.10
af_O07177_97_215_3.30.1010.10 Alpha Beta;2-Layer Sandwich;Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4;Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 0.786 107 216 3.30.1010.10
af_Q9VIG3_1_153_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.6396 5 77 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A0Q8WII6-F1-model_v4 Maltokinase (EC 2.7.1.175) (Maltose-1-phosphate synthase) 0.9681 8 463 GO:0005978
GO:0016301
AF-A0A6H1A4H4-F1-model_v4 Maltokinase (EC 2.7.1.175) (Maltose-1-phosphate synthase) 0.9626 2 464 GO:0005978
GO:0016301
AF-A0A0Q8WII6-F1-model_v4 Maltokinase (EC 2.7.1.175) (Maltose-1-phosphate synthase) 0.9593 8 463 GO:0005978
GO:0016301
AF-A0A6H1A4H4-F1-model_v4 Maltokinase (EC 2.7.1.175) (Maltose-1-phosphate synthase) 0.9585 2 464 GO:0005978
GO:0016301
AF-A0A2S9FHY6-F1-model_v4 Maltokinase 0.954 144 379 GO:0016301

Map