F265306

General Info

Members Datasets Scaffolds Average Seq Length
174 127 168 387

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0090832|Ga0501034_0090832_1806_2978
Length 390
Sequence MSAPDFLPFALPDIGDDEINEVVDALRSGWVTTGPKTKRFEEDFAAFLGEPGLHAVAVNSATAGLHLALEALGLGPGDEVITTTHTFTATAEVARYLGADVRLVDIDPATLNIDAAAVEAAVGPRTRAIVPVHYAGLAADMDAIGAVAARHGLGVVEDAAHALPTTWRGRLVGTLGSSSTVFSFYANKTMTTGEGGMLVTRDEAVFKRSKVMRLHGINRDAFDRYTSQAPSWYYEIVAPGFKYNLTDVAAAMGLHQLRRVRGFQVRREQIARQFDEAFADLPLILPPRPRHAGDLHAWHLYVVRLRDDAPLGRDAFIEAMYKAGIGCSVHYIPLHLHPYWRERYGLSPAQFPHSQHAFERMVSLPLYTRMGEADVQRVIDTVRRLLTQGA

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
4 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
5 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
6 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
44 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
45 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
48 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
73 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
74 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
75 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
76 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
77 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
78 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
79 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
80 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
81 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
93 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
96 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
97 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
98 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
99 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
103 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
104 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
105 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
106 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
107 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
108 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
109 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
110 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
111 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
112 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
113 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
114 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
115 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
117 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
118 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
119 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
120 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
121 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
122 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
123 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
124 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
125 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
126 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
127 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.55
Metatranscriptomes 0
Isolates 3.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.39
Nodule 0
Rhizoplane 2.87
Rhizosphere 64.94
Stem 0
Stem Tuber 0
Unclassified 13.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10015795 3300001979 Bacteria 2745
2 JGI25152J39213_1002287 3300002773 Bacteria 7391
3 JGI25150J39212_1006585 3300002774 Bacteria 2389
4 JGI25153J46596_10006572 3300003215 Bacteria 5862
5 Ga0055526_1011260 3300003771 Bacteria 4053
6 Ga0065165_1002976 3300005262 Bacteria 12860
7 Ga0070658_10015162 3300005327 Bacteria 6168
8 Ga0070670_100075814 3300005331 Bacteria 2889
9 Ga0070666_10009824 3300005335 Bacteria 5975
10 Ga0068868_100011718 3300005338 Bacteria 6388
11 Ga0070675_100022260 3300005354 Bacteria 5062
12 Ga0070675_100040376 3300005354 Bacteria 3809
13 Ga0070671_100016583 3300005355 Bacteria 5955
14 Ga0070671_100030192 3300005355 Bacteria 4473
15 Ga0070674_100006461 3300005356 Bacteria 6842
16 Ga0070673_100077922 3300005364 Bacteria 2679
17 Ga0070673_100278213 3300005364 Bacteria 1467
18 Ga0070667_100017292 3300005367 Bacteria 5975
19 Ga0070696_100020539 3300005546 Bacteria 4475
20 Ga0070665_100065315 3300005548 Bacteria 3650
21 Ga0068855_100009084 3300005563 Bacteria 12012
22 Ga0068857_100022784 3300005577 Bacteria 5510
23 Ga0068864_100183009 3300005618 Bacteria 1916
24 Ga0068863_100030094 3300005841 Bacteria 5186
25 Ga0068858_100008718 3300005842 Bacteria 9736
26 Ga0075367_10012250 3300006178 Bacteria 4564
27 Ga0075367_10025220 3300006178 Bacteria 3360
28 Ga0075366_10000139 3300006195 Bacteria 30628
29 Ga0075366_10001435 3300006195 Bacteria 11892
30 Ga0075366_10007660 3300006195 Bacteria 5974
31 Ga0075366_10152348 3300006195 Bacteria 1400
32 Ga0097621_100102408 3300006237 Bacteria 2410
33 Ga0075370_10000064 3300006353 Bacteria 31947
34 Ga0075370_10001457 3300006353 Bacteria 10272
35 Ga0075370_10072327 3300006353 Bacteria 1974
36 Ga0068871_100025620 3300006358 Bacteria 4592
37 Ga0068871_100150937 3300006358 Bacteria 1982
38 Ga0075430_100003833 3300006846 Bacteria 12661
39 Ga0075429_100000282 3300006880 Bacteria 35849
40 Ga0075429_100004462 3300006880 Bacteria 12041
41 Ga0105240_10028904 3300009093 Bacteria 7232
42 Ga0105240_10051159 3300009093 Bacteria 5202
43 Ga0105237_10006482 3300009545 Bacteria 12972
44 Ga0105239_10019070 3300010375 Bacteria 7580
45 Ga0157378_10461148 3300013297 Bacteria 1263
46 Ga0163163_10094111 3300014325 Bacteria 3013
47 Ga0157379_10019808 3300014968 Bacteria 5946
48 Ga0157376_10055388 3300014969 Bacteria 3308
49 Ga0207425_1000363 3300025245 Bacteria 31420
50 Ga0209129_1000062 3300025258 Bacteria 240655
51 Ga0209673_1006813 3300025273 Bacteria 5424
52 Ga0209564_1000176 3300025295 Bacteria 152363
53 Ga0209758_1000129 3300025297 Bacteria 185022
54 Ga0209758_1000327 3300025297 Bacteria 89663
55 Ga0207656_10072653 3300025321 Bacteria 1532
56 Ga0207682_10003203 3300025893 Bacteria 7163
57 Ga0207645_10029597 3300025907 Bacteria 3530
58 Ga0207645_10035431 3300025907 Bacteria 3204
59 Ga0207705_10040038 3300025909 Bacteria 3359
60 Ga0207684_10154641 3300025910 Unclassified 1974
61 Ga0207695_10091708 3300025913 Bacteria 3051
62 Ga0207681_10127133 3300025923 Bacteria 1879
63 Ga0207650_10145995 3300025925 Bacteria 1863
64 Ga0207659_10002872 3300025926 Bacteria 10254
65 Ga0207687_10338963 3300025927 Bacteria 1222
66 Ga0207644_10011823 3300025931 Bacteria 5781
67 Ga0207644_10016848 3300025931 Bacteria 4923
68 Ga0207644_10179172 3300025931 Bacteria 1660
69 Ga0207644_10220875 3300025931 Bacteria 1502
70 Ga0207706_10094802 3300025933 Bacteria 2626
71 Ga0207669_10039292 3300025937 Bacteria 2733
72 Ga0207691_10003158 3300025940 Bacteria 16114
73 Ga0207689_10085614 3300025942 Bacteria 2591
74 Ga0207667_10069442 3300025949 Bacteria 3667
75 Ga0207640_10210620 3300025981 Bacteria 1480
76 Ga0207677_10007705 3300026023 Bacteria 5977
77 Ga0207641_10035307 3300026088 Bacteria 4164
78 Ga0207648_10006456 3300026089 Bacteria 11652
79 Ga0207648_10034445 3300026089 Bacteria 4464
80 Ga0207648_10068034 3300026089 Bacteria 3104
81 Ga0207648_10069898 3300026089 Bacteria 3060
82 Ga0207676_10047540 3300026095 Bacteria 3326
83 Ga0207676_10197013 3300026095 Bacteria 1777
84 Ga0207674_10023266 3300026116 Bacteria 6638
85 Ga0207683_10025352 3300026121 Bacteria 5115
86 Ga0207698_10075982 3300026142 Bacteria 2687
87 Ga0307517_10039449 3300028786 Bacteria 5185
88 Ga0307515_10002251 3300028794 Bacteria 42303
89 Ga0307515_10003180 3300028794 Bacteria 34757
90 Ga0307515_10131674 3300028794 Bacteria 2749
91 Ga0307515_10220485 3300028794 Bacteria 1716
92 Ga0307512_10098665 3300030522 Bacteria 1992
93 Ga0265339_10006657 3300031249 Bacteria 7560
94 Ga0265327_10064200 3300031251 Bacteria 1862
95 Ga0307513_10006149 3300031456 Bacteria 15752
96 Ga0307513_10028696 3300031456 Bacteria 6356
97 Ga0307513_10318564 3300031456 Bacteria 1314
98 Ga0307509_10000904 3300031507 Bacteria 50711
99 Ga0307509_10001327 3300031507 Bacteria 41950
100 Ga0307509_10073588 3300031507 Bacteria 3557
101 Ga0307509_10113933 3300031507 Bacteria 2700
102 Ga0307509_10149189 3300031507 Bacteria 2258
103 Ga0307509_10209441 3300031507 Bacteria 1776
104 Ga0307508_10000123 3300031616 Bacteria 92439
105 Ga0307508_10019053 3300031616 Bacteria 6236
106 Ga0307508_10062028 3300031616 Bacteria 3300
107 Ga0265342_10011073 3300031712 Bacteria 6190
108 Ga0307516_10000127 3300031730 Bacteria 90180
109 Ga0307516_10000438 3300031730 Bacteria 54750
110 Ga0307405_10013335 3300031731 Bacteria 4381
111 Ga0307413_10006847 3300031824 Bacteria 5243
112 Ga0307410_10005155 3300031852 Bacteria 6876
113 Ga0307410_10068163 3300031852 Bacteria 2456
114 Ga0307406_10005634 3300031901 Bacteria 6846
115 Ga0307406_10098230 3300031901 Bacteria 1988
116 Ga0307407_10074429 3300031903 Bacteria 2032
117 Ga0307412_10028342 3300031911 Bacteria 3502
118 Ga0307412_10090655 3300031911 Bacteria 2137
119 Ga0307409_100028410 3300031995 Bacteria 3984
120 Ga0307409_100240446 3300031995 Bacteria 1648
121 Ga0307416_100045577 3300032002 Bacteria 3454
122 Ga0307411_10002555 3300032005 Bacteria 8117
123 Ga0307411_10009352 3300032005 Bacteria 5147
124 Ga0307415_100024725 3300032126 Bacteria 3757
125 Ga0307510_10000122 3300033180 Bacteria 62024
126 Ga0373937_0041184 3300036401 Bacteria 4214
127 Ga0395905_0002018 3300037471 Bacteria 23204
128 Ga0439455_0002824 3300042012 Bacteria 3227
129 Ga0451577_0000697 3300042876 Bacteria 52454
130 Ga0451577_0010832 3300042876 Bacteria 8668
131 Ga0466972_0005063 3300044658 Bacteria 6606
132 Ga0466966_0042192 3300044684 Bacteria 2930
133 Ga0453684_0001396 3300044712 Bacteria 69884
134 Ga0453684_0157285 3300044712 Bacteria 2693
135 Ga0466959_0220552 3300045049 Bacteria 1315
136 Ga0495629_0108283 3300046459 Bacteria 1938
137 Ga0495610_0016888 3300046512 Bacteria 4182
138 Ga0495620_0051975 3300046515 Bacteria 1742
139 Ga0495632_0010786 3300046519 Bacteria 5380
140 Ga0495632_0023201 3300046519 Bacteria 3316
141 Ga0495645_0052522 3300046543 Bacteria 2965
142 Ga0495625_0000929 3300046660 Bacteria 39380
143 Ga0495625_0010045 3300046660 Bacteria 7867
144 Ga0495659_0034441 3300046664 Bacteria 1781
145 Ga0495604_0000852 3300047317 Bacteria 25474
146 Ga0495686_0106046 3300047472 Bacteria 1690
147 Ga0496102_0003049 3300048905 Bacteria 14192
148 Ga0496104_0000036 3300048907 Bacteria 180472
149 Ga0496106_0040507 3300048909 Bacteria 3489
150 Ga0496110_0000496 3300048913 Bacteria 26770
151 Ga0496111_0005319 3300048914 Bacteria 8224
152 Ga0501034_0090832 3300049571 Bacteria 3051
153 Ga0501044_0318632 3300049823 Bacteria 1480
154 nmdc:mga03683_3510_c1 3300050489 Bacteria 5075
155 nmdc:mga0k408_155476_c1 3300050493 Bacteria 1362
156 nmdc:mga0k408_42420_c1 3300050493 Bacteria 2621
157 nmdc:mga06z11_43792_c1 3300050494 Bacteria 2254
158 nmdc:mga07m45_13666_c1 3300050496 Bacteria 4312
159 nmdc:mga07m45_1742_c1 3300050496 Bacteria 10017
160 nmdc:mga09592_425_c1 3300050508 Bacteria 31113
161 nmdc:mga09592_7794_c1 3300050508 Bacteria 8702
162 nmdc:mga0qj67_6075_c1 3300050509 Bacteria 8847
163 Ga0500578_0000079 3300053086 Bacteria 107137
164 Ga0500578_0085721 3300053086 Bacteria 2001
165 Ga0500568_0015245 3300053139 Bacteria 3445
166 Ga0500604_0022137 3300053151 Bacteria 1802
167 Ga0500619_000048 3300053154 Bacteria 37454
168 Ga0500645_005510 3300053730 Bacteria 4643

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_0000036 Ga0496104_0000036_98352_99461 358
2 3300048913 Ga0496110_0000496 Ga0496110_0000496_7483_8592 358
3 3300048914 Ga0496111_0005319 Ga0496111_0005319_2677_3786 358
4 3300042876 Ga0451577_0000697 Ga0451577_0000697_43047_44276 359
5 3300042012 Ga0439455_0002824 Ga0439455_0002824_1762_2931 364
6 3300009093 Ga0105240_10028904 Ga0105240_100289045 367
7 3300044658 Ga0466972_0005063 Ga0466972_0005063_1990_3150 367
8 3300047317 Ga0495604_0000852 Ga0495604_0000852_4791_5900 367
9 3300044684 Ga0466966_0042192 Ga0466966_0042192_1745_2902 370
10 3300045049 Ga0466959_0220552 Ga0466959_0220552_17_1174 370
11 3300014325 Ga0163163_10094111 Ga0163163_100941112 371
12 3300014968 Ga0157379_10019808 Ga0157379_100198085 371
13 3300014969 Ga0157376_10055388 Ga0157376_100553883 371
14 3300031911 Ga0307412_10028342 Ga0307412_100283423 372
15 3300005335 Ga0070666_10009824 Ga0070666_100098244 374
16 3300005338 Ga0068868_100011718 Ga0068868_1000117183 374
17 3300005355 Ga0070671_100016583 Ga0070671_1000165833 374
18 3300005367 Ga0070667_100017292 Ga0070667_1000172922 374
19 3300005841 Ga0068863_100030094 Ga0068863_1000300943 374
20 3300005842 Ga0068858_100008718 Ga0068858_1000087184 374
21 3300006358 Ga0068871_100025620 Ga0068871_1000256203 374
22 3300025321 Ga0207656_10072653 Ga0207656_100726531 374
23 3300025931 Ga0207644_10011823 Ga0207644_100118235 374
24 3300026023 Ga0207677_10007705 Ga0207677_100077054 374
25 3300026088 Ga0207641_10035307 Ga0207641_100353073 374
26 3300026089 Ga0207648_10068034 Ga0207648_100680342 374
27 3300026095 Ga0207676_10047540 Ga0207676_100475403 374
28 3300037471 Ga0395905_0002018 Ga0395905_0002018_21297_22469 374
29 3300031251 Ga0265327_10064200 Ga0265327_100642001 376
30 3300049823 Ga0501044_0318632 Ga0501044_0318632_196_1386 376
31 3300044712 Ga0453684_0157285 Ga0453684_0157285_1318_2475 378
32 3300028794 Ga0307515_10220485 Ga0307515_102204852 379
33 3300031456 Ga0307513_10028696 Ga0307513_100286966 379
34 3300005546 Ga0070696_100020539 Ga0070696_1000205393 380
35 3300006880 Ga0075429_100004462 Ga0075429_1000044628 380
36 3300031730 Ga0307516_10000127 Ga0307516_1000012731 380
37 3300050508 nmdc:mga09592_7794_c1 nmdc:mga09592_7794_c1_2339_3496 380
38 3300006237 Ga0097621_100102408 Ga0097621_1001024083 381
39 3300042876 Ga0451577_0010832 Ga0451577_0010832_6229_7407 382
40 iso_pu_bacteria 2588253510 2588289890 383
41 iso_pu_bacteria 2643221592 2643972311 383
42 iso_pu_bacteria 2643221625 2644141578 383
43 iso_pu_bacteria 2643221648 2644275651 383
44 3300005364 Ga0070673_100077922 Ga0070673_1000779223 385
45 3300025910 Ga0207684_10154641 Ga0207684_101546412 385
46 3300028794 Ga0307515_10002251 Ga0307515_1000225115 385
47 3300030522 Ga0307512_10098665 Ga0307512_100986652 385
48 3300031456 Ga0307513_10318564 Ga0307513_103185641 385
49 3300031824 Ga0307413_10006847 Ga0307413_100068473 385
50 3300031852 Ga0307410_10068163 Ga0307410_100681632 385
51 3300031901 Ga0307406_10098230 Ga0307406_100982302 385
52 3300031903 Ga0307407_10074429 Ga0307407_100744293 385
53 3300031995 Ga0307409_100240446 Ga0307409_1002404462 385
54 3300032005 Ga0307411_10009352 Ga0307411_100093522 385
55 3300036401 Ga0373937_0041184 Ga0373937_0041184_2821_3981 385
56 3300046459 Ga0495629_0108283 Ga0495629_0108283_53_1213 385
57 3300046543 Ga0495645_0052522 Ga0495645_0052522_360_1517 385
58 3300002773 JGI25152J39213_1002287 JGI25152J39213_10022872 386
59 3300002774 JGI25150J39212_1006585 JGI25150J39212_10065852 386
60 3300003771 Ga0055526_1011260 Ga0055526_10112603 386
61 3300006353 Ga0075370_10001457 Ga0075370_100014573 386
62 3300025245 Ga0207425_1000363 Ga0207425_10003636 386
63 3300025258 Ga0209129_1000062 Ga0209129_1000062129 386
64 3300025295 Ga0209564_1000176 Ga0209564_100017649 386
65 3300025297 Ga0209758_1000129 Ga0209758_100012940 386
66 3300044712 Ga0453684_0001396 Ga0453684_0001396_22248_23411 386
67 3300046664 Ga0495659_0034441 Ga0495659_0034441_119_1306 386
68 3300049571 Ga0501034_0090832 Ga0501034_0090832_1806_2978 386
69 3300050496 nmdc:mga07m45_13666_c1 nmdc:mga07m45_13666_c1_1209_2372 386
70 3300005262 Ga0065165_1002976 Ga0065165_10029763 387
71 3300005331 Ga0070670_100075814 Ga0070670_1000758143 387
72 3300005354 Ga0070675_100022260 Ga0070675_1000222605 387
73 3300005355 Ga0070671_100030192 Ga0070671_1000301923 387
74 3300005356 Ga0070674_100006461 Ga0070674_1000064612 387
75 3300005618 Ga0068864_100183009 Ga0068864_1001830092 387
76 3300006178 Ga0075367_10012250 Ga0075367_100122503 387
77 3300006178 Ga0075367_10025220 Ga0075367_100252203 387
78 3300006195 Ga0075366_10000139 Ga0075366_100001393 387
79 3300006195 Ga0075366_10001435 Ga0075366_100014353 387
80 3300006195 Ga0075366_10007660 Ga0075366_100076605 387
81 3300006353 Ga0075370_10000064 Ga0075370_100000648 387
82 3300006353 Ga0075370_10072327 Ga0075370_100723273 387
83 3300006358 Ga0068871_100150937 Ga0068871_1001509372 387
84 3300006846 Ga0075430_100003833 Ga0075430_1000038339 387
85 3300006880 Ga0075429_100000282 Ga0075429_10000028231 387
86 3300009093 Ga0105240_10051159 Ga0105240_100511591 387
87 3300009545 Ga0105237_10006482 Ga0105237_1000648210 387
88 3300010375 Ga0105239_10019070 Ga0105239_100190703 387
89 3300025893 Ga0207682_10003203 Ga0207682_100032033 387
90 3300025907 Ga0207645_10029597 Ga0207645_100295972 387
91 3300025913 Ga0207695_10091708 Ga0207695_100917083 387
92 3300025923 Ga0207681_10127133 Ga0207681_101271332 387
93 3300025925 Ga0207650_10145995 Ga0207650_101459952 387
94 3300025926 Ga0207659_10002872 Ga0207659_100028722 387
95 3300025927 Ga0207687_10338963 Ga0207687_103389631 387
96 3300025931 Ga0207644_10016848 Ga0207644_100168483 387
97 3300025931 Ga0207644_10220875 Ga0207644_102208751 387
98 3300025933 Ga0207706_10094802 Ga0207706_100948022 387
99 3300025937 Ga0207669_10039292 Ga0207669_100392921 387
100 3300025940 Ga0207691_10003158 Ga0207691_1000315811 387
101 3300025981 Ga0207640_10210620 Ga0207640_102106202 387
102 3300026089 Ga0207648_10006456 Ga0207648_100064566 387
103 3300026089 Ga0207648_10069898 Ga0207648_100698983 387
104 3300026095 Ga0207676_10197013 Ga0207676_101970132 387
105 3300026142 Ga0207698_10075982 Ga0207698_100759823 387
106 3300028786 Ga0307517_10039449 Ga0307517_100394495 387
107 3300031456 Ga0307513_10006149 Ga0307513_100061494 387
108 3300031507 Ga0307509_10209441 Ga0307509_102094411 387
109 3300031616 Ga0307508_10000123 Ga0307508_1000012318 387
110 3300031731 Ga0307405_10013335 Ga0307405_100133353 387
111 3300031852 Ga0307410_10005155 Ga0307410_100051554 387
112 3300031901 Ga0307406_10005634 Ga0307406_100056347 387
113 3300031911 Ga0307412_10090655 Ga0307412_100906552 387
114 3300031995 Ga0307409_100028410 Ga0307409_1000284102 387
115 3300032002 Ga0307416_100045577 Ga0307416_1000455772 387
116 3300032005 Ga0307411_10002555 Ga0307411_100025555 387
117 3300032126 Ga0307415_100024725 Ga0307415_1000247252 387
118 3300033180 Ga0307510_10000122 Ga0307510_1000012210 387
119 3300046519 Ga0495632_0010786 Ga0495632_0010786_3744_4907 387
120 3300048905 Ga0496102_0003049 Ga0496102_0003049_4729_5895 387
121 3300048909 Ga0496106_0040507 Ga0496106_0040507_485_1648 387
122 3300050493 nmdc:mga0k408_42420_c1 nmdc:mga0k408_42420_c1_1294_2460 387
123 3300050494 nmdc:mga06z11_43792_c1 nmdc:mga06z11_43792_c1_813_1979 387
124 3300050496 nmdc:mga07m45_1742_c1 nmdc:mga07m45_1742_c1_2965_4131 387
125 3300050508 nmdc:mga09592_425_c1 nmdc:mga09592_425_c1_25722_26885 387
126 3300050509 nmdc:mga0qj67_6075_c1 nmdc:mga0qj67_6075_c1_1390_2553 387
127 3300053139 Ga0500568_0015245 Ga0500568_0015245_2095_3258 387
128 3300053151 Ga0500604_0022137 Ga0500604_0022137_567_1730 387
129 3300053154 Ga0500619_000048 Ga0500619_000048_34238_35404 387
130 iso_pu_bacteria 2585428057 2587728076 387
131 iso_pu_bacteria 2585428058 2587731137 387
132 3300005327 Ga0070658_10015162 Ga0070658_100151625 388
133 3300005548 Ga0070665_100065315 Ga0070665_1000653155 388
134 3300013297 Ga0157378_10461148 Ga0157378_104611481 388
135 3300025909 Ga0207705_10040038 Ga0207705_100400382 388
136 3300031249 Ga0265339_10006657 Ga0265339_100066572 388
137 3300031507 Ga0307509_10073588 Ga0307509_100735883 388
138 3300031507 Ga0307509_10113933 Ga0307509_101139334 388
139 3300031507 Ga0307509_10149189 Ga0307509_101491893 388
140 3300031616 Ga0307508_10019053 Ga0307508_100190538 388
141 3300031616 Ga0307508_10062028 Ga0307508_100620282 388
142 3300031712 Ga0265342_10011073 Ga0265342_100110733 388
143 3300006195 Ga0075366_10152348 Ga0075366_101523481 389
144 3300028794 Ga0307515_10131674 Ga0307515_101316743 389
145 3300031507 Ga0307509_10000904 Ga0307509_1000090424 389
146 3300031507 Ga0307509_10001327 Ga0307509_1000132731 389
147 3300050493 nmdc:mga0k408_155476_c1 nmdc:mga0k408_155476_c1_48_1217 389
148 3300001979 JGI24740J21852_10015795 JGI24740J21852_100157952 390
149 3300003215 JGI25153J46596_10006572 JGI25153J46596_100065727 390
150 3300005354 Ga0070675_100040376 Ga0070675_1000403763 390
151 3300005364 Ga0070673_100278213 Ga0070673_1002782131 390
152 3300005563 Ga0068855_100009084 Ga0068855_1000090847 390
153 3300005577 Ga0068857_100022784 Ga0068857_1000227846 390
154 3300025273 Ga0209673_1006813 Ga0209673_10068136 390
155 3300025297 Ga0209758_1000327 Ga0209758_100032740 390
156 3300025907 Ga0207645_10035431 Ga0207645_100354313 390
157 3300025931 Ga0207644_10179172 Ga0207644_101791722 390
158 3300025942 Ga0207689_10085614 Ga0207689_100856142 390
159 3300025949 Ga0207667_10069442 Ga0207667_100694423 390
160 3300026089 Ga0207648_10034445 Ga0207648_100344453 390
161 3300026116 Ga0207674_10023266 Ga0207674_100232667 390
162 3300026121 Ga0207683_10025352 Ga0207683_100253522 390
163 3300028794 Ga0307515_10003180 Ga0307515_1000318030 390
164 3300031730 Ga0307516_10000438 Ga0307516_1000043817 390
165 3300046512 Ga0495610_0016888 Ga0495610_0016888_1351_2523 390
166 3300046515 Ga0495620_0051975 Ga0495620_0051975_29_1201 390
167 3300046519 Ga0495632_0023201 Ga0495632_0023201_1615_2787 390
168 3300046660 Ga0495625_0000929 Ga0495625_0000929_36815_37987 390
169 3300046660 Ga0495625_0010045 Ga0495625_0010045_1838_3022 390
170 3300047472 Ga0495686_0106046 Ga0495686_0106046_243_1415 390
171 3300050489 nmdc:mga03683_3510_c1 nmdc:mga03683_3510_c1_239_1420 390
172 3300053086 Ga0500578_0000079 Ga0500578_0000079_64807_65982 390
173 3300053086 Ga0500578_0085721 Ga0500578_0085721_354_1541 390
174 3300053730 Ga0500645_005510 Ga0500645_005510_2218_3405 390

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01041

DegT_DnrJ_EryC1

DegT/DnrJ/EryC1/StrS aminotransferase family

12

383

0.96

PF00155

Aminotran_1_2

Aminotransferase class I and II

18

163

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mdx-assembly1.cif.gz_A crystal structure of arnb transferase with pyridoxal 5' phosphate 0.968 10 390
1mdo-assembly1.cif.gz_A crystal structure of arnb aminotransferase with pyridomine 5' phosphate 0.9656 10 390
8su6-assembly1.cif.gz_B crystal structure of arnb transferase from klebsiella aerogenes (lattice translocation disorder, p1 form2) 0.9634 10 390
1mdx-assembly1.cif.gz_A crystal structure of arnb transferase with pyridoxal 5' phosphate 0.9628 10 390
4oca-assembly1.cif.gz_A-2 cryatal structure of arnb k188a complexted with plp and udp-ara4n 0.9614 9 390
ID Description Score Start End Superfamily
af_Q58466_2_255_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9881 10 262 3.40.640.10
1mdxA01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9749 10 262 3.40.640.10
4lc3B01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9674 9 262 3.40.640.10
af_Q58466_2_255_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.965 10 262 3.40.640.10
1mdxA01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.963 10 262 3.40.640.10
ID Description Score Start End GO Terms
AF-X1S2V2-F1-model_v4 DegT/DnrJ/EryC1/StrS aminotransferase family protein 0.9837 82 220 GO:0000271
GO:0008483
GO:0030170
AF-A0A2M8Q735-F1-model_v4 Aminotransferase DegT 0.9792 20 157 GO:0000271
GO:0008483
GO:0030170
AF-A0A7C3BBA8-F1-model_v4 DegT/DnrJ/EryC1/StrS family aminotransferase 0.9781 10 389 GO:0000271
GO:0008483
GO:0030170
AF-A0A1Q7RLX2-F1-model_v4 UDP-4-amino-4, 6-dideoxy-N-acetyl-beta-L-altrosamine transaminase 0.9779 11 389 GO:0000271
GO:0008483
GO:0030170
AF-A0A3D5DEC6-F1-model_v4 Aminotransferase DegT 0.9776 73 195 GO:0000271
GO:0008483
GO:0030170

Feature Viewer

pLDDT pTM Quality
93.28 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map