F265306
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 174 | 127 | 168 | 387 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0090832|Ga0501034_0090832_1806_2978 |
| Length | 390 |
| Sequence | MSAPDFLPFALPDIGDDEINEVVDALRSGWVTTGPKTKRFEEDFAAFLGEPGLHAVAVNSATAGLHLALEALGLGPGDEVITTTHTFTATAEVARYLGADVRLVDIDPATLNIDAAAVEAAVGPRTRAIVPVHYAGLAADMDAIGAVAARHGLGVVEDAAHALPTTWRGRLVGTLGSSSTVFSFYANKTMTTGEGGMLVTRDEAVFKRSKVMRLHGINRDAFDRYTSQAPSWYYEIVAPGFKYNLTDVAAAMGLHQLRRVRGFQVRREQIARQFDEAFADLPLILPPRPRHAGDLHAWHLYVVRLRDDAPLGRDAFIEAMYKAGIGCSVHYIPLHLHPYWRERYGLSPAQFPHSQHAFERMVSLPLYTRMGEADVQRVIDTVRRLLTQGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 2 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 3 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 4 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 5 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 6 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 7 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 8 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 9 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 25 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 26 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 27 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 28 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 29 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 30 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 31 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 33 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 34 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 35 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 36 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 44 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 45 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 46 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 47 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 48 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 73 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 74 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 75 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 76 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 77 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 78 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 79 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 80 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 81 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 82 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 83 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 84 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 85 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 86 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 87 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 88 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 89 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 90 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 91 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 92 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 93 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 94 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 95 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 96 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 97 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 98 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 99 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 100 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 101 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 111 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 112 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 113 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 114 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 115 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 116 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 117 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 118 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 119 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 120 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 121 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 122 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 123 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 124 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 125 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 126 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 127 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.55 |
| Metatranscriptomes | 0 |
| Isolates | 3.45 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.39 |
| Nodule | 0 |
| Rhizoplane | 2.87 |
| Rhizosphere | 64.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10015795 | 3300001979 | Bacteria | 2745 |
| 2 | JGI25152J39213_1002287 | 3300002773 | Bacteria | 7391 |
| 3 | JGI25150J39212_1006585 | 3300002774 | Bacteria | 2389 |
| 4 | JGI25153J46596_10006572 | 3300003215 | Bacteria | 5862 |
| 5 | Ga0055526_1011260 | 3300003771 | Bacteria | 4053 |
| 6 | Ga0065165_1002976 | 3300005262 | Bacteria | 12860 |
| 7 | Ga0070658_10015162 | 3300005327 | Bacteria | 6168 |
| 8 | Ga0070670_100075814 | 3300005331 | Bacteria | 2889 |
| 9 | Ga0070666_10009824 | 3300005335 | Bacteria | 5975 |
| 10 | Ga0068868_100011718 | 3300005338 | Bacteria | 6388 |
| 11 | Ga0070675_100022260 | 3300005354 | Bacteria | 5062 |
| 12 | Ga0070675_100040376 | 3300005354 | Bacteria | 3809 |
| 13 | Ga0070671_100016583 | 3300005355 | Bacteria | 5955 |
| 14 | Ga0070671_100030192 | 3300005355 | Bacteria | 4473 |
| 15 | Ga0070674_100006461 | 3300005356 | Bacteria | 6842 |
| 16 | Ga0070673_100077922 | 3300005364 | Bacteria | 2679 |
| 17 | Ga0070673_100278213 | 3300005364 | Bacteria | 1467 |
| 18 | Ga0070667_100017292 | 3300005367 | Bacteria | 5975 |
| 19 | Ga0070696_100020539 | 3300005546 | Bacteria | 4475 |
| 20 | Ga0070665_100065315 | 3300005548 | Bacteria | 3650 |
| 21 | Ga0068855_100009084 | 3300005563 | Bacteria | 12012 |
| 22 | Ga0068857_100022784 | 3300005577 | Bacteria | 5510 |
| 23 | Ga0068864_100183009 | 3300005618 | Bacteria | 1916 |
| 24 | Ga0068863_100030094 | 3300005841 | Bacteria | 5186 |
| 25 | Ga0068858_100008718 | 3300005842 | Bacteria | 9736 |
| 26 | Ga0075367_10012250 | 3300006178 | Bacteria | 4564 |
| 27 | Ga0075367_10025220 | 3300006178 | Bacteria | 3360 |
| 28 | Ga0075366_10000139 | 3300006195 | Bacteria | 30628 |
| 29 | Ga0075366_10001435 | 3300006195 | Bacteria | 11892 |
| 30 | Ga0075366_10007660 | 3300006195 | Bacteria | 5974 |
| 31 | Ga0075366_10152348 | 3300006195 | Bacteria | 1400 |
| 32 | Ga0097621_100102408 | 3300006237 | Bacteria | 2410 |
| 33 | Ga0075370_10000064 | 3300006353 | Bacteria | 31947 |
| 34 | Ga0075370_10001457 | 3300006353 | Bacteria | 10272 |
| 35 | Ga0075370_10072327 | 3300006353 | Bacteria | 1974 |
| 36 | Ga0068871_100025620 | 3300006358 | Bacteria | 4592 |
| 37 | Ga0068871_100150937 | 3300006358 | Bacteria | 1982 |
| 38 | Ga0075430_100003833 | 3300006846 | Bacteria | 12661 |
| 39 | Ga0075429_100000282 | 3300006880 | Bacteria | 35849 |
| 40 | Ga0075429_100004462 | 3300006880 | Bacteria | 12041 |
| 41 | Ga0105240_10028904 | 3300009093 | Bacteria | 7232 |
| 42 | Ga0105240_10051159 | 3300009093 | Bacteria | 5202 |
| 43 | Ga0105237_10006482 | 3300009545 | Bacteria | 12972 |
| 44 | Ga0105239_10019070 | 3300010375 | Bacteria | 7580 |
| 45 | Ga0157378_10461148 | 3300013297 | Bacteria | 1263 |
| 46 | Ga0163163_10094111 | 3300014325 | Bacteria | 3013 |
| 47 | Ga0157379_10019808 | 3300014968 | Bacteria | 5946 |
| 48 | Ga0157376_10055388 | 3300014969 | Bacteria | 3308 |
| 49 | Ga0207425_1000363 | 3300025245 | Bacteria | 31420 |
| 50 | Ga0209129_1000062 | 3300025258 | Bacteria | 240655 |
| 51 | Ga0209673_1006813 | 3300025273 | Bacteria | 5424 |
| 52 | Ga0209564_1000176 | 3300025295 | Bacteria | 152363 |
| 53 | Ga0209758_1000129 | 3300025297 | Bacteria | 185022 |
| 54 | Ga0209758_1000327 | 3300025297 | Bacteria | 89663 |
| 55 | Ga0207656_10072653 | 3300025321 | Bacteria | 1532 |
| 56 | Ga0207682_10003203 | 3300025893 | Bacteria | 7163 |
| 57 | Ga0207645_10029597 | 3300025907 | Bacteria | 3530 |
| 58 | Ga0207645_10035431 | 3300025907 | Bacteria | 3204 |
| 59 | Ga0207705_10040038 | 3300025909 | Bacteria | 3359 |
| 60 | Ga0207684_10154641 | 3300025910 | Unclassified | 1974 |
| 61 | Ga0207695_10091708 | 3300025913 | Bacteria | 3051 |
| 62 | Ga0207681_10127133 | 3300025923 | Bacteria | 1879 |
| 63 | Ga0207650_10145995 | 3300025925 | Bacteria | 1863 |
| 64 | Ga0207659_10002872 | 3300025926 | Bacteria | 10254 |
| 65 | Ga0207687_10338963 | 3300025927 | Bacteria | 1222 |
| 66 | Ga0207644_10011823 | 3300025931 | Bacteria | 5781 |
| 67 | Ga0207644_10016848 | 3300025931 | Bacteria | 4923 |
| 68 | Ga0207644_10179172 | 3300025931 | Bacteria | 1660 |
| 69 | Ga0207644_10220875 | 3300025931 | Bacteria | 1502 |
| 70 | Ga0207706_10094802 | 3300025933 | Bacteria | 2626 |
| 71 | Ga0207669_10039292 | 3300025937 | Bacteria | 2733 |
| 72 | Ga0207691_10003158 | 3300025940 | Bacteria | 16114 |
| 73 | Ga0207689_10085614 | 3300025942 | Bacteria | 2591 |
| 74 | Ga0207667_10069442 | 3300025949 | Bacteria | 3667 |
| 75 | Ga0207640_10210620 | 3300025981 | Bacteria | 1480 |
| 76 | Ga0207677_10007705 | 3300026023 | Bacteria | 5977 |
| 77 | Ga0207641_10035307 | 3300026088 | Bacteria | 4164 |
| 78 | Ga0207648_10006456 | 3300026089 | Bacteria | 11652 |
| 79 | Ga0207648_10034445 | 3300026089 | Bacteria | 4464 |
| 80 | Ga0207648_10068034 | 3300026089 | Bacteria | 3104 |
| 81 | Ga0207648_10069898 | 3300026089 | Bacteria | 3060 |
| 82 | Ga0207676_10047540 | 3300026095 | Bacteria | 3326 |
| 83 | Ga0207676_10197013 | 3300026095 | Bacteria | 1777 |
| 84 | Ga0207674_10023266 | 3300026116 | Bacteria | 6638 |
| 85 | Ga0207683_10025352 | 3300026121 | Bacteria | 5115 |
| 86 | Ga0207698_10075982 | 3300026142 | Bacteria | 2687 |
| 87 | Ga0307517_10039449 | 3300028786 | Bacteria | 5185 |
| 88 | Ga0307515_10002251 | 3300028794 | Bacteria | 42303 |
| 89 | Ga0307515_10003180 | 3300028794 | Bacteria | 34757 |
| 90 | Ga0307515_10131674 | 3300028794 | Bacteria | 2749 |
| 91 | Ga0307515_10220485 | 3300028794 | Bacteria | 1716 |
| 92 | Ga0307512_10098665 | 3300030522 | Bacteria | 1992 |
| 93 | Ga0265339_10006657 | 3300031249 | Bacteria | 7560 |
| 94 | Ga0265327_10064200 | 3300031251 | Bacteria | 1862 |
| 95 | Ga0307513_10006149 | 3300031456 | Bacteria | 15752 |
| 96 | Ga0307513_10028696 | 3300031456 | Bacteria | 6356 |
| 97 | Ga0307513_10318564 | 3300031456 | Bacteria | 1314 |
| 98 | Ga0307509_10000904 | 3300031507 | Bacteria | 50711 |
| 99 | Ga0307509_10001327 | 3300031507 | Bacteria | 41950 |
| 100 | Ga0307509_10073588 | 3300031507 | Bacteria | 3557 |
| 101 | Ga0307509_10113933 | 3300031507 | Bacteria | 2700 |
| 102 | Ga0307509_10149189 | 3300031507 | Bacteria | 2258 |
| 103 | Ga0307509_10209441 | 3300031507 | Bacteria | 1776 |
| 104 | Ga0307508_10000123 | 3300031616 | Bacteria | 92439 |
| 105 | Ga0307508_10019053 | 3300031616 | Bacteria | 6236 |
| 106 | Ga0307508_10062028 | 3300031616 | Bacteria | 3300 |
| 107 | Ga0265342_10011073 | 3300031712 | Bacteria | 6190 |
| 108 | Ga0307516_10000127 | 3300031730 | Bacteria | 90180 |
| 109 | Ga0307516_10000438 | 3300031730 | Bacteria | 54750 |
| 110 | Ga0307405_10013335 | 3300031731 | Bacteria | 4381 |
| 111 | Ga0307413_10006847 | 3300031824 | Bacteria | 5243 |
| 112 | Ga0307410_10005155 | 3300031852 | Bacteria | 6876 |
| 113 | Ga0307410_10068163 | 3300031852 | Bacteria | 2456 |
| 114 | Ga0307406_10005634 | 3300031901 | Bacteria | 6846 |
| 115 | Ga0307406_10098230 | 3300031901 | Bacteria | 1988 |
| 116 | Ga0307407_10074429 | 3300031903 | Bacteria | 2032 |
| 117 | Ga0307412_10028342 | 3300031911 | Bacteria | 3502 |
| 118 | Ga0307412_10090655 | 3300031911 | Bacteria | 2137 |
| 119 | Ga0307409_100028410 | 3300031995 | Bacteria | 3984 |
| 120 | Ga0307409_100240446 | 3300031995 | Bacteria | 1648 |
| 121 | Ga0307416_100045577 | 3300032002 | Bacteria | 3454 |
| 122 | Ga0307411_10002555 | 3300032005 | Bacteria | 8117 |
| 123 | Ga0307411_10009352 | 3300032005 | Bacteria | 5147 |
| 124 | Ga0307415_100024725 | 3300032126 | Bacteria | 3757 |
| 125 | Ga0307510_10000122 | 3300033180 | Bacteria | 62024 |
| 126 | Ga0373937_0041184 | 3300036401 | Bacteria | 4214 |
| 127 | Ga0395905_0002018 | 3300037471 | Bacteria | 23204 |
| 128 | Ga0439455_0002824 | 3300042012 | Bacteria | 3227 |
| 129 | Ga0451577_0000697 | 3300042876 | Bacteria | 52454 |
| 130 | Ga0451577_0010832 | 3300042876 | Bacteria | 8668 |
| 131 | Ga0466972_0005063 | 3300044658 | Bacteria | 6606 |
| 132 | Ga0466966_0042192 | 3300044684 | Bacteria | 2930 |
| 133 | Ga0453684_0001396 | 3300044712 | Bacteria | 69884 |
| 134 | Ga0453684_0157285 | 3300044712 | Bacteria | 2693 |
| 135 | Ga0466959_0220552 | 3300045049 | Bacteria | 1315 |
| 136 | Ga0495629_0108283 | 3300046459 | Bacteria | 1938 |
| 137 | Ga0495610_0016888 | 3300046512 | Bacteria | 4182 |
| 138 | Ga0495620_0051975 | 3300046515 | Bacteria | 1742 |
| 139 | Ga0495632_0010786 | 3300046519 | Bacteria | 5380 |
| 140 | Ga0495632_0023201 | 3300046519 | Bacteria | 3316 |
| 141 | Ga0495645_0052522 | 3300046543 | Bacteria | 2965 |
| 142 | Ga0495625_0000929 | 3300046660 | Bacteria | 39380 |
| 143 | Ga0495625_0010045 | 3300046660 | Bacteria | 7867 |
| 144 | Ga0495659_0034441 | 3300046664 | Bacteria | 1781 |
| 145 | Ga0495604_0000852 | 3300047317 | Bacteria | 25474 |
| 146 | Ga0495686_0106046 | 3300047472 | Bacteria | 1690 |
| 147 | Ga0496102_0003049 | 3300048905 | Bacteria | 14192 |
| 148 | Ga0496104_0000036 | 3300048907 | Bacteria | 180472 |
| 149 | Ga0496106_0040507 | 3300048909 | Bacteria | 3489 |
| 150 | Ga0496110_0000496 | 3300048913 | Bacteria | 26770 |
| 151 | Ga0496111_0005319 | 3300048914 | Bacteria | 8224 |
| 152 | Ga0501034_0090832 | 3300049571 | Bacteria | 3051 |
| 153 | Ga0501044_0318632 | 3300049823 | Bacteria | 1480 |
| 154 | nmdc:mga03683_3510_c1 | 3300050489 | Bacteria | 5075 |
| 155 | nmdc:mga0k408_155476_c1 | 3300050493 | Bacteria | 1362 |
| 156 | nmdc:mga0k408_42420_c1 | 3300050493 | Bacteria | 2621 |
| 157 | nmdc:mga06z11_43792_c1 | 3300050494 | Bacteria | 2254 |
| 158 | nmdc:mga07m45_13666_c1 | 3300050496 | Bacteria | 4312 |
| 159 | nmdc:mga07m45_1742_c1 | 3300050496 | Bacteria | 10017 |
| 160 | nmdc:mga09592_425_c1 | 3300050508 | Bacteria | 31113 |
| 161 | nmdc:mga09592_7794_c1 | 3300050508 | Bacteria | 8702 |
| 162 | nmdc:mga0qj67_6075_c1 | 3300050509 | Bacteria | 8847 |
| 163 | Ga0500578_0000079 | 3300053086 | Bacteria | 107137 |
| 164 | Ga0500578_0085721 | 3300053086 | Bacteria | 2001 |
| 165 | Ga0500568_0015245 | 3300053139 | Bacteria | 3445 |
| 166 | Ga0500604_0022137 | 3300053151 | Bacteria | 1802 |
| 167 | Ga0500619_000048 | 3300053154 | Bacteria | 37454 |
| 168 | Ga0500645_005510 | 3300053730 | Bacteria | 4643 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048907 | Ga0496104_0000036 | Ga0496104_0000036_98352_99461 | 358 |
| 2 | 3300048913 | Ga0496110_0000496 | Ga0496110_0000496_7483_8592 | 358 |
| 3 | 3300048914 | Ga0496111_0005319 | Ga0496111_0005319_2677_3786 | 358 |
| 4 | 3300042876 | Ga0451577_0000697 | Ga0451577_0000697_43047_44276 | 359 |
| 5 | 3300042012 | Ga0439455_0002824 | Ga0439455_0002824_1762_2931 | 364 |
| 6 | 3300009093 | Ga0105240_10028904 | Ga0105240_100289045 | 367 |
| 7 | 3300044658 | Ga0466972_0005063 | Ga0466972_0005063_1990_3150 | 367 |
| 8 | 3300047317 | Ga0495604_0000852 | Ga0495604_0000852_4791_5900 | 367 |
| 9 | 3300044684 | Ga0466966_0042192 | Ga0466966_0042192_1745_2902 | 370 |
| 10 | 3300045049 | Ga0466959_0220552 | Ga0466959_0220552_17_1174 | 370 |
| 11 | 3300014325 | Ga0163163_10094111 | Ga0163163_100941112 | 371 |
| 12 | 3300014968 | Ga0157379_10019808 | Ga0157379_100198085 | 371 |
| 13 | 3300014969 | Ga0157376_10055388 | Ga0157376_100553883 | 371 |
| 14 | 3300031911 | Ga0307412_10028342 | Ga0307412_100283423 | 372 |
| 15 | 3300005335 | Ga0070666_10009824 | Ga0070666_100098244 | 374 |
| 16 | 3300005338 | Ga0068868_100011718 | Ga0068868_1000117183 | 374 |
| 17 | 3300005355 | Ga0070671_100016583 | Ga0070671_1000165833 | 374 |
| 18 | 3300005367 | Ga0070667_100017292 | Ga0070667_1000172922 | 374 |
| 19 | 3300005841 | Ga0068863_100030094 | Ga0068863_1000300943 | 374 |
| 20 | 3300005842 | Ga0068858_100008718 | Ga0068858_1000087184 | 374 |
| 21 | 3300006358 | Ga0068871_100025620 | Ga0068871_1000256203 | 374 |
| 22 | 3300025321 | Ga0207656_10072653 | Ga0207656_100726531 | 374 |
| 23 | 3300025931 | Ga0207644_10011823 | Ga0207644_100118235 | 374 |
| 24 | 3300026023 | Ga0207677_10007705 | Ga0207677_100077054 | 374 |
| 25 | 3300026088 | Ga0207641_10035307 | Ga0207641_100353073 | 374 |
| 26 | 3300026089 | Ga0207648_10068034 | Ga0207648_100680342 | 374 |
| 27 | 3300026095 | Ga0207676_10047540 | Ga0207676_100475403 | 374 |
| 28 | 3300037471 | Ga0395905_0002018 | Ga0395905_0002018_21297_22469 | 374 |
| 29 | 3300031251 | Ga0265327_10064200 | Ga0265327_100642001 | 376 |
| 30 | 3300049823 | Ga0501044_0318632 | Ga0501044_0318632_196_1386 | 376 |
| 31 | 3300044712 | Ga0453684_0157285 | Ga0453684_0157285_1318_2475 | 378 |
| 32 | 3300028794 | Ga0307515_10220485 | Ga0307515_102204852 | 379 |
| 33 | 3300031456 | Ga0307513_10028696 | Ga0307513_100286966 | 379 |
| 34 | 3300005546 | Ga0070696_100020539 | Ga0070696_1000205393 | 380 |
| 35 | 3300006880 | Ga0075429_100004462 | Ga0075429_1000044628 | 380 |
| 36 | 3300031730 | Ga0307516_10000127 | Ga0307516_1000012731 | 380 |
| 37 | 3300050508 | nmdc:mga09592_7794_c1 | nmdc:mga09592_7794_c1_2339_3496 | 380 |
| 38 | 3300006237 | Ga0097621_100102408 | Ga0097621_1001024083 | 381 |
| 39 | 3300042876 | Ga0451577_0010832 | Ga0451577_0010832_6229_7407 | 382 |
| 40 | iso_pu_bacteria | 2588253510 | 2588289890 | 383 |
| 41 | iso_pu_bacteria | 2643221592 | 2643972311 | 383 |
| 42 | iso_pu_bacteria | 2643221625 | 2644141578 | 383 |
| 43 | iso_pu_bacteria | 2643221648 | 2644275651 | 383 |
| 44 | 3300005364 | Ga0070673_100077922 | Ga0070673_1000779223 | 385 |
| 45 | 3300025910 | Ga0207684_10154641 | Ga0207684_101546412 | 385 |
| 46 | 3300028794 | Ga0307515_10002251 | Ga0307515_1000225115 | 385 |
| 47 | 3300030522 | Ga0307512_10098665 | Ga0307512_100986652 | 385 |
| 48 | 3300031456 | Ga0307513_10318564 | Ga0307513_103185641 | 385 |
| 49 | 3300031824 | Ga0307413_10006847 | Ga0307413_100068473 | 385 |
| 50 | 3300031852 | Ga0307410_10068163 | Ga0307410_100681632 | 385 |
| 51 | 3300031901 | Ga0307406_10098230 | Ga0307406_100982302 | 385 |
| 52 | 3300031903 | Ga0307407_10074429 | Ga0307407_100744293 | 385 |
| 53 | 3300031995 | Ga0307409_100240446 | Ga0307409_1002404462 | 385 |
| 54 | 3300032005 | Ga0307411_10009352 | Ga0307411_100093522 | 385 |
| 55 | 3300036401 | Ga0373937_0041184 | Ga0373937_0041184_2821_3981 | 385 |
| 56 | 3300046459 | Ga0495629_0108283 | Ga0495629_0108283_53_1213 | 385 |
| 57 | 3300046543 | Ga0495645_0052522 | Ga0495645_0052522_360_1517 | 385 |
| 58 | 3300002773 | JGI25152J39213_1002287 | JGI25152J39213_10022872 | 386 |
| 59 | 3300002774 | JGI25150J39212_1006585 | JGI25150J39212_10065852 | 386 |
| 60 | 3300003771 | Ga0055526_1011260 | Ga0055526_10112603 | 386 |
| 61 | 3300006353 | Ga0075370_10001457 | Ga0075370_100014573 | 386 |
| 62 | 3300025245 | Ga0207425_1000363 | Ga0207425_10003636 | 386 |
| 63 | 3300025258 | Ga0209129_1000062 | Ga0209129_1000062129 | 386 |
| 64 | 3300025295 | Ga0209564_1000176 | Ga0209564_100017649 | 386 |
| 65 | 3300025297 | Ga0209758_1000129 | Ga0209758_100012940 | 386 |
| 66 | 3300044712 | Ga0453684_0001396 | Ga0453684_0001396_22248_23411 | 386 |
| 67 | 3300046664 | Ga0495659_0034441 | Ga0495659_0034441_119_1306 | 386 |
| 68 | 3300049571 | Ga0501034_0090832 | Ga0501034_0090832_1806_2978 | 386 |
| 69 | 3300050496 | nmdc:mga07m45_13666_c1 | nmdc:mga07m45_13666_c1_1209_2372 | 386 |
| 70 | 3300005262 | Ga0065165_1002976 | Ga0065165_10029763 | 387 |
| 71 | 3300005331 | Ga0070670_100075814 | Ga0070670_1000758143 | 387 |
| 72 | 3300005354 | Ga0070675_100022260 | Ga0070675_1000222605 | 387 |
| 73 | 3300005355 | Ga0070671_100030192 | Ga0070671_1000301923 | 387 |
| 74 | 3300005356 | Ga0070674_100006461 | Ga0070674_1000064612 | 387 |
| 75 | 3300005618 | Ga0068864_100183009 | Ga0068864_1001830092 | 387 |
| 76 | 3300006178 | Ga0075367_10012250 | Ga0075367_100122503 | 387 |
| 77 | 3300006178 | Ga0075367_10025220 | Ga0075367_100252203 | 387 |
| 78 | 3300006195 | Ga0075366_10000139 | Ga0075366_100001393 | 387 |
| 79 | 3300006195 | Ga0075366_10001435 | Ga0075366_100014353 | 387 |
| 80 | 3300006195 | Ga0075366_10007660 | Ga0075366_100076605 | 387 |
| 81 | 3300006353 | Ga0075370_10000064 | Ga0075370_100000648 | 387 |
| 82 | 3300006353 | Ga0075370_10072327 | Ga0075370_100723273 | 387 |
| 83 | 3300006358 | Ga0068871_100150937 | Ga0068871_1001509372 | 387 |
| 84 | 3300006846 | Ga0075430_100003833 | Ga0075430_1000038339 | 387 |
| 85 | 3300006880 | Ga0075429_100000282 | Ga0075429_10000028231 | 387 |
| 86 | 3300009093 | Ga0105240_10051159 | Ga0105240_100511591 | 387 |
| 87 | 3300009545 | Ga0105237_10006482 | Ga0105237_1000648210 | 387 |
| 88 | 3300010375 | Ga0105239_10019070 | Ga0105239_100190703 | 387 |
| 89 | 3300025893 | Ga0207682_10003203 | Ga0207682_100032033 | 387 |
| 90 | 3300025907 | Ga0207645_10029597 | Ga0207645_100295972 | 387 |
| 91 | 3300025913 | Ga0207695_10091708 | Ga0207695_100917083 | 387 |
| 92 | 3300025923 | Ga0207681_10127133 | Ga0207681_101271332 | 387 |
| 93 | 3300025925 | Ga0207650_10145995 | Ga0207650_101459952 | 387 |
| 94 | 3300025926 | Ga0207659_10002872 | Ga0207659_100028722 | 387 |
| 95 | 3300025927 | Ga0207687_10338963 | Ga0207687_103389631 | 387 |
| 96 | 3300025931 | Ga0207644_10016848 | Ga0207644_100168483 | 387 |
| 97 | 3300025931 | Ga0207644_10220875 | Ga0207644_102208751 | 387 |
| 98 | 3300025933 | Ga0207706_10094802 | Ga0207706_100948022 | 387 |
| 99 | 3300025937 | Ga0207669_10039292 | Ga0207669_100392921 | 387 |
| 100 | 3300025940 | Ga0207691_10003158 | Ga0207691_1000315811 | 387 |
| 101 | 3300025981 | Ga0207640_10210620 | Ga0207640_102106202 | 387 |
| 102 | 3300026089 | Ga0207648_10006456 | Ga0207648_100064566 | 387 |
| 103 | 3300026089 | Ga0207648_10069898 | Ga0207648_100698983 | 387 |
| 104 | 3300026095 | Ga0207676_10197013 | Ga0207676_101970132 | 387 |
| 105 | 3300026142 | Ga0207698_10075982 | Ga0207698_100759823 | 387 |
| 106 | 3300028786 | Ga0307517_10039449 | Ga0307517_100394495 | 387 |
| 107 | 3300031456 | Ga0307513_10006149 | Ga0307513_100061494 | 387 |
| 108 | 3300031507 | Ga0307509_10209441 | Ga0307509_102094411 | 387 |
| 109 | 3300031616 | Ga0307508_10000123 | Ga0307508_1000012318 | 387 |
| 110 | 3300031731 | Ga0307405_10013335 | Ga0307405_100133353 | 387 |
| 111 | 3300031852 | Ga0307410_10005155 | Ga0307410_100051554 | 387 |
| 112 | 3300031901 | Ga0307406_10005634 | Ga0307406_100056347 | 387 |
| 113 | 3300031911 | Ga0307412_10090655 | Ga0307412_100906552 | 387 |
| 114 | 3300031995 | Ga0307409_100028410 | Ga0307409_1000284102 | 387 |
| 115 | 3300032002 | Ga0307416_100045577 | Ga0307416_1000455772 | 387 |
| 116 | 3300032005 | Ga0307411_10002555 | Ga0307411_100025555 | 387 |
| 117 | 3300032126 | Ga0307415_100024725 | Ga0307415_1000247252 | 387 |
| 118 | 3300033180 | Ga0307510_10000122 | Ga0307510_1000012210 | 387 |
| 119 | 3300046519 | Ga0495632_0010786 | Ga0495632_0010786_3744_4907 | 387 |
| 120 | 3300048905 | Ga0496102_0003049 | Ga0496102_0003049_4729_5895 | 387 |
| 121 | 3300048909 | Ga0496106_0040507 | Ga0496106_0040507_485_1648 | 387 |
| 122 | 3300050493 | nmdc:mga0k408_42420_c1 | nmdc:mga0k408_42420_c1_1294_2460 | 387 |
| 123 | 3300050494 | nmdc:mga06z11_43792_c1 | nmdc:mga06z11_43792_c1_813_1979 | 387 |
| 124 | 3300050496 | nmdc:mga07m45_1742_c1 | nmdc:mga07m45_1742_c1_2965_4131 | 387 |
| 125 | 3300050508 | nmdc:mga09592_425_c1 | nmdc:mga09592_425_c1_25722_26885 | 387 |
| 126 | 3300050509 | nmdc:mga0qj67_6075_c1 | nmdc:mga0qj67_6075_c1_1390_2553 | 387 |
| 127 | 3300053139 | Ga0500568_0015245 | Ga0500568_0015245_2095_3258 | 387 |
| 128 | 3300053151 | Ga0500604_0022137 | Ga0500604_0022137_567_1730 | 387 |
| 129 | 3300053154 | Ga0500619_000048 | Ga0500619_000048_34238_35404 | 387 |
| 130 | iso_pu_bacteria | 2585428057 | 2587728076 | 387 |
| 131 | iso_pu_bacteria | 2585428058 | 2587731137 | 387 |
| 132 | 3300005327 | Ga0070658_10015162 | Ga0070658_100151625 | 388 |
| 133 | 3300005548 | Ga0070665_100065315 | Ga0070665_1000653155 | 388 |
| 134 | 3300013297 | Ga0157378_10461148 | Ga0157378_104611481 | 388 |
| 135 | 3300025909 | Ga0207705_10040038 | Ga0207705_100400382 | 388 |
| 136 | 3300031249 | Ga0265339_10006657 | Ga0265339_100066572 | 388 |
| 137 | 3300031507 | Ga0307509_10073588 | Ga0307509_100735883 | 388 |
| 138 | 3300031507 | Ga0307509_10113933 | Ga0307509_101139334 | 388 |
| 139 | 3300031507 | Ga0307509_10149189 | Ga0307509_101491893 | 388 |
| 140 | 3300031616 | Ga0307508_10019053 | Ga0307508_100190538 | 388 |
| 141 | 3300031616 | Ga0307508_10062028 | Ga0307508_100620282 | 388 |
| 142 | 3300031712 | Ga0265342_10011073 | Ga0265342_100110733 | 388 |
| 143 | 3300006195 | Ga0075366_10152348 | Ga0075366_101523481 | 389 |
| 144 | 3300028794 | Ga0307515_10131674 | Ga0307515_101316743 | 389 |
| 145 | 3300031507 | Ga0307509_10000904 | Ga0307509_1000090424 | 389 |
| 146 | 3300031507 | Ga0307509_10001327 | Ga0307509_1000132731 | 389 |
| 147 | 3300050493 | nmdc:mga0k408_155476_c1 | nmdc:mga0k408_155476_c1_48_1217 | 389 |
| 148 | 3300001979 | JGI24740J21852_10015795 | JGI24740J21852_100157952 | 390 |
| 149 | 3300003215 | JGI25153J46596_10006572 | JGI25153J46596_100065727 | 390 |
| 150 | 3300005354 | Ga0070675_100040376 | Ga0070675_1000403763 | 390 |
| 151 | 3300005364 | Ga0070673_100278213 | Ga0070673_1002782131 | 390 |
| 152 | 3300005563 | Ga0068855_100009084 | Ga0068855_1000090847 | 390 |
| 153 | 3300005577 | Ga0068857_100022784 | Ga0068857_1000227846 | 390 |
| 154 | 3300025273 | Ga0209673_1006813 | Ga0209673_10068136 | 390 |
| 155 | 3300025297 | Ga0209758_1000327 | Ga0209758_100032740 | 390 |
| 156 | 3300025907 | Ga0207645_10035431 | Ga0207645_100354313 | 390 |
| 157 | 3300025931 | Ga0207644_10179172 | Ga0207644_101791722 | 390 |
| 158 | 3300025942 | Ga0207689_10085614 | Ga0207689_100856142 | 390 |
| 159 | 3300025949 | Ga0207667_10069442 | Ga0207667_100694423 | 390 |
| 160 | 3300026089 | Ga0207648_10034445 | Ga0207648_100344453 | 390 |
| 161 | 3300026116 | Ga0207674_10023266 | Ga0207674_100232667 | 390 |
| 162 | 3300026121 | Ga0207683_10025352 | Ga0207683_100253522 | 390 |
| 163 | 3300028794 | Ga0307515_10003180 | Ga0307515_1000318030 | 390 |
| 164 | 3300031730 | Ga0307516_10000438 | Ga0307516_1000043817 | 390 |
| 165 | 3300046512 | Ga0495610_0016888 | Ga0495610_0016888_1351_2523 | 390 |
| 166 | 3300046515 | Ga0495620_0051975 | Ga0495620_0051975_29_1201 | 390 |
| 167 | 3300046519 | Ga0495632_0023201 | Ga0495632_0023201_1615_2787 | 390 |
| 168 | 3300046660 | Ga0495625_0000929 | Ga0495625_0000929_36815_37987 | 390 |
| 169 | 3300046660 | Ga0495625_0010045 | Ga0495625_0010045_1838_3022 | 390 |
| 170 | 3300047472 | Ga0495686_0106046 | Ga0495686_0106046_243_1415 | 390 |
| 171 | 3300050489 | nmdc:mga03683_3510_c1 | nmdc:mga03683_3510_c1_239_1420 | 390 |
| 172 | 3300053086 | Ga0500578_0000079 | Ga0500578_0000079_64807_65982 | 390 |
| 173 | 3300053086 | Ga0500578_0085721 | Ga0500578_0085721_354_1541 | 390 |
| 174 | 3300053730 | Ga0500645_005510 | Ga0500645_005510_2218_3405 | 390 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1mdx-assembly1.cif.gz_A | crystal structure of arnb transferase with pyridoxal 5' phosphate | 0.968 | 10 | 390 |
| 1mdo-assembly1.cif.gz_A | crystal structure of arnb aminotransferase with pyridomine 5' phosphate | 0.9656 | 10 | 390 |
| 8su6-assembly1.cif.gz_B | crystal structure of arnb transferase from klebsiella aerogenes (lattice translocation disorder, p1 form2) | 0.9634 | 10 | 390 |
| 1mdx-assembly1.cif.gz_A | crystal structure of arnb transferase with pyridoxal 5' phosphate | 0.9628 | 10 | 390 |
| 4oca-assembly1.cif.gz_A-2 | cryatal structure of arnb k188a complexted with plp and udp-ara4n | 0.9614 | 9 | 390 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58466_2_255_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9881 | 10 | 262 | 3.40.640.10 |
| 1mdxA01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9749 | 10 | 262 | 3.40.640.10 |
| 4lc3B01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9674 | 9 | 262 | 3.40.640.10 |
| af_Q58466_2_255_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.965 | 10 | 262 | 3.40.640.10 |
| 1mdxA01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.963 | 10 | 262 | 3.40.640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X1S2V2-F1-model_v4 | DegT/DnrJ/EryC1/StrS aminotransferase family protein | 0.9837 | 82 | 220 |
GO:0000271
GO:0008483 GO:0030170 |
| AF-A0A2M8Q735-F1-model_v4 | Aminotransferase DegT | 0.9792 | 20 | 157 |
GO:0000271
GO:0008483 GO:0030170 |
| AF-A0A7C3BBA8-F1-model_v4 | DegT/DnrJ/EryC1/StrS family aminotransferase | 0.9781 | 10 | 389 |
GO:0000271
GO:0008483 GO:0030170 |
| AF-A0A1Q7RLX2-F1-model_v4 | UDP-4-amino-4, 6-dideoxy-N-acetyl-beta-L-altrosamine transaminase | 0.9779 | 11 | 389 |
GO:0000271
GO:0008483 GO:0030170 |
| AF-A0A3D5DEC6-F1-model_v4 | Aminotransferase DegT | 0.9776 | 73 | 195 |
GO:0000271
GO:0008483 GO:0030170 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar