F265266

General Info

Members Datasets Scaffolds Average Seq Length
174 135 348 285

Family's Representative Sequence

Representative Sequence 3300048923|Ga0496120_0018884|Ga0496120_0018884_1773_2732
Length 319
Sequence MKNGGLAFNLANINNTMQSSTVPAWGMSRMKVLVTGASGQLGKDVVKVFQEQGHDVLGYDREQLDITDLQQTVKIVGQYQPDAVIHCAAYTAVDAAETDVDGAYQVNAAGTRNMALAAEKVGAKLVYISTDYVFDGTAKQPYHEYDNTNPQSIYGKSKRAGEVLTQTLSSRYFIVRTSWVYGLHGNNFVKTMLKLGQEKPLLQVVNDQKGSPTYTVDLARFLAELIQTEKYGVYHASNSGSCTWYEFTQAILQDAAEILDAKITAKLEPCSTEQFPRPAARPRNSVMEHIAIRTNGLNDLRDWREGLRDFLQECLSKSE

Samples

Sample ID Description Type Environment
1 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
2 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
3 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
11 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
12 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
13 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
14 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
15 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
16 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
17 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
18 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
19 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
20 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
21 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
22 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
23 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
24 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
25 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
34 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
35 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
36 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
37 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
38 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
39 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
40 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
41 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
42 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
43 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
44 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
45 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
46 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
47 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
48 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
49 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
50 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
51 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
52 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
53 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
54 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
55 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
56 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
57 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
58 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
59 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
60 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
61 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
62 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
63 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
64 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
65 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
66 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
67 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
68 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
69 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
70 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
71 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
72 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
73 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
74 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
75 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
76 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
77 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
78 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
79 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
80 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
81 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
82 2547132424 Nocardia nova SH22a Isolate Unclassified
83 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
84 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
85 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
86 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
87 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
88 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
89 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
90 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
91 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
92 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
93 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
94 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
95 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
96 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
97 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
98 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
99 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
100 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
101 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
102 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
103 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
104 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
105 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
106 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
107 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
108 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
109 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
110 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
111 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
112 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
113 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
114 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
115 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
116 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
117 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
118 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
119 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
120 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
121 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
122 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
123 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
124 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
125 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
126 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
127 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
128 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
129 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
130 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
131 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
132 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
133 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
134 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
135 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 67.24
Metatranscriptomes 0.57
Isolates 32.18

Biome Distribution

Category Percentage (%)
Aerial Root 1.15
Bulb 0
Endosphere 11.49
Nodule 0
Rhizoplane 0.57
Rhizosphere 55.17
Stem 0
Stem Tuber 0
Unclassified 1.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496120_0018884 3300048923 Bacteria 4429
2 Ga0055538_1000114 3300003751 Bacteria 61531
3 Ga0055538_1000617 3300003751 Bacteria 11606
4 Ga0055541_1000286 3300003841 Bacteria 17140
5 Ga0070680_100000042 3300005336 Bacteria 65213
6 Ga0070660_100014018 3300005339 Bacteria 5770
7 Ga0070714_100042717 3300005435 Bacteria 3831
8 Ga0070681_10000056 3300005458 Bacteria 79899
9 Ga0070679_100000140 3300005530 Bacteria 58509
10 Ga0081455_10003814 3300005937 Bacteria 17199
11 Ga0081455_10217038 3300005937 Bacteria 1421
12 Ga0075364_10207594 3300006051 Bacteria 1328
13 Ga0075362_10000173 3300006177 Bacteria 17794
14 Ga0075362_10058124 3300006177 Unclassified 1744
15 Ga0075369_10007213 3300006186 Bacteria 4226
16 Ga0075428_100001136 3300006844 Bacteria 28448
17 Ga0105244_10017088 3300009036 Bacteria 4111
18 Ga0111539_10023380 3300009094 Bacteria 7593
19 Ga0105237_10000018 3300009545 Bacteria 237291
20 Ga0105238_10100496 3300009551 Bacteria 2876
21 Ga0105246_10001767 3300011119 Bacteria 12932
22 Ga0213876_10071127 3300021384 Bacteria 1838
23 Ga0209784_100075 3300025224 Bacteria 139902
24 Ga0209566_100091 3300025225 Bacteria 141100
25 Ga0209566_104311 3300025225 Bacteria 1964
26 Ga0209437_100449 3300025233 Bacteria 34010
27 Ga0209675_1016126 3300025291 Bacteria 2188
28 Ga0209025_1000946 3300025294 Bacteria 44053
29 Ga0207655_1006125 3300025728 Bacteria 8026
30 Ga0207655_1031088 3300025728 Bacteria 2468
31 Ga0207707_10000196 3300025912 Bacteria 63970
32 Ga0207671_10000049 3300025914 Bacteria 194682
33 Ga0207660_10000101 3300025917 Bacteria 47860
34 Ga0207657_10021260 3300025919 Bacteria 6112
35 Ga0207652_10000110 3300025921 Bacteria 89235
36 Ga0207694_10067578 3300025924 Bacteria 2790
37 Ga0207664_10013933 3300025929 Bacteria 5795
38 Ga0207428_10120620 3300027907 Bacteria 2011
39 Ga0316576_10096568 3300031727 Bacteria 2206
40 Ga0395899_0002037 3300037312 Bacteria 16641
41 Ga0395899_0035776 3300037312 Bacteria 3727
42 Ga0436365_0277839 3300039437 Bacteria 8384
43 Ga0436363_0575584 3300039450 Bacteria 1626
44 Ga0453683_0033272 3300044673 Bacteria 3251
45 Ga0453684_0000814 3300044712 Bacteria 105915
46 Ga0466958_0045453 3300045836 Bacteria 2649
47 Ga0466967_0240468 3300045976 Bacteria 1727
48 Ga0466967_0683407 3300045976 Bacteria 1016
49 Ga0495590_0012984 3300046457 Bacteria 3073
50 Ga0496114_0000972 3300048917 Bacteria 21459
51 Ga0496116_0023901 3300048919 Bacteria 4537
52 Ga0496117_0000084 3300048920 Bacteria 214308
53 Ga0496117_0000344 3300048920 Bacteria 82195
54 Ga0496117_0149463 3300048920 Bacteria 1385
55 Ga0496118_0074276 3300048921 Bacteria 2431
56 Ga0496118_0197045 3300048921 Bacteria 1197
57 Ga0496119_0000231 3300048922 Bacteria 78482
58 Ga0496119_0048628 3300048922 Bacteria 2628
59 Ga0496120_0000574 3300048923 Bacteria 56160
60 Ga0496120_0000677 3300048923 Bacteria 50036
61 Ga0496120_0005057 3300048923 Bacteria 10690
62 Ga0496120_0036277 3300048923 Bacteria 2936
63 Ga0496121_0004014 3300048924 Bacteria 20267
64 Ga0496121_0093495 3300048924 Bacteria 2341
65 Ga0496121_0096990 3300048924 Bacteria 2286
66 Ga0496121_0186076 3300048924 Bacteria 1494
67 Ga0496121_0240178 3300048924 Bacteria 1263
68 Ga0496122_0000314 3300048925 Bacteria 106928
69 Ga0496122_0002241 3300048925 Bacteria 28097
70 Ga0496122_0006058 3300048925 Bacteria 14091
71 Ga0496122_0095728 3300048925 Bacteria 2005
72 Ga0496122_0122889 3300048925 Bacteria 1669
73 Ga0496122_0137770 3300048925 Bacteria 1534
74 Ga0496123_0003281 3300048926 Bacteria 18334
75 Ga0496123_0009091 3300048926 Bacteria 8997
76 Ga0496124_0017155 3300048927 Bacteria 6842
77 Ga0496124_0143345 3300048927 Bacteria 1882
78 Ga0496125_0000556 3300048928 Bacteria 64234
79 Ga0496125_0002025 3300048928 Bacteria 27455
80 Ga0496125_0272292 3300048928 Bacteria 1054
81 Ga0496126_0000060 3300048929 Bacteria 264944
82 Ga0496126_0005818 3300048929 Bacteria 13940
83 Ga0496126_0070125 3300048929 Bacteria 3123
84 Ga0496126_0086456 3300048929 Bacteria 2763
85 Ga0501309_000176 3300049129 Bacteria 4221
86 Ga0501034_0149455 3300049571 Bacteria 2312
87 Ga0501036_0130828 3300049572 Bacteria 2119
88 Ga0501039_0143613 3300049575 Bacteria 1875
89 Ga0501042_0163134 3300049578 Bacteria 1608
90 Ga0501042_0178220 3300049578 Bacteria 1533
91 Ga0501046_0216017 3300049580 Bacteria 1422
92 Ga0501048_0108620 3300049582 Bacteria 1959
93 Ga0501069_0135852 3300049585 Bacteria 1409
94 Ga0501070_0049253 3300049586 Bacteria 3499
95 Ga0501071_0075275 3300049587 Bacteria 2464
96 Ga0501071_0114793 3300049587 Bacteria 1992
97 Ga0501071_0118515 3300049587 Bacteria 1961
98 Ga0501072_0156131 3300049588 Bacteria 1819
99 Ga0501074_0211905 3300049590 Bacteria 1380
100 Ga0501075_0115584 3300049591 Bacteria 2040
101 Ga0501076_0058321 3300049592 Bacteria 3068
102 Ga0501076_0060062 3300049592 Bacteria 3024
103 Ga0501076_0485376 3300049592 Bacteria 1018
104 Ga0501079_0260976 3300049741 Bacteria 1354
105 Ga0501080_0133147 3300049742 Bacteria 2301
106 Ga0501081_0165927 3300049743 Bacteria 1593
107 Ga0501083_0203104 3300049744 Bacteria 1292
108 Ga0501045_0424257 3300049824 Bacteria 989
109 nmdc:mga03683_225_c1 3300050489 Bacteria 17847
110 nmdc:mga03683_71152_c1 3300050489 Unclassified 1487
111 nmdc:mga03683_71893_c1 3300050489 Bacteria 1480
112 nmdc:mga00v17_225632_c1 3300050491 Bacteria 1213
113 nmdc:mga08y16_229600_c1 3300050511 Bacteria 1920
114 Ga0500651_0186728 3300053093 Bacteria 1228
115 Ga0500559_0000163 3300053136 Bacteria 52657
116 Ga0500616_0000403 3300053153 Bacteria 59207
117 Ga0501084_0495182 3300054114 Bacteria 1033
118 Ga0530510_0151342 3300061734 Unclassified 1714
119 2512730023 2512564039 Bacteria 8739048
120 2548698596 2547132424 Bacteria 8348532
121 2563930273 2563366752 Bacteria 4961801
122 2578338943 2576861424 Bacteria 5270569
123 2580934632 2579778775 Bacteria 5360914
124 2621277399 2619619294 Bacteria 5575484
125 2643736862 2643221543 Bacteria 6628015
126 2723606245 2721755693 Bacteria 6126117
127 2728531389 2728368933 Bacteria 7044283
128 2730136868 2728369359 Bacteria 5621728
129 2738887241 2738541308 Bacteria 7020677
130 2753039107 2751185725 Bacteria 5740550
131 2753327618 2751185792 Bacteria 5739090
132 2753808566 2751185905 Bacteria 6142767
133 2802438131 2802428803 Bacteria 5806948
134 2821118165 2821111986 Bacteria 6894338
135 2864739591 2864733723 Bacteria 6770668
136 2881638117 2881636855 Bacteria 5205297
137 2885529871 2885526491 Bacteria 7164189
138 2888579633 2888578766 Bacteria 6743310
139 2888579651 2888578766 Bacteria 6743310
140 2889048058 2889042446 Bacteria 7618936
141 2889051731 2889049205 Bacteria 7524325
142 2889276797 2889276214 Bacteria 5979355
143 2889299754 2889295896 Bacteria 4704906
144 2904117200 2904113452 Bacteria 7796941
145 2904168100 2904162308 Bacteria 7086713
146 2904494327 2904490793 Bacteria 7046938
147 2904596514 2904595352 Bacteria 6124848
148 2907207357 2907202186 Bacteria 6632024
149 2919165165 2919160200 Bacteria 6929020
150 2919425724 2919425241 Bacteria 8055701
151 2919719266 2919713450 Bacteria 7431245
152 2931385164 2931384279 Bacteria 7299545
153 2939680670 2939679117 Bacteria 6921672
154 2939706744 2939702853 Bacteria 5139229
155 2945996205 2945991243 Bacteria 7008369
156 2946058895 2946053406 Bacteria 6978655
157 2956941193 2956939328 Bacteria 3474458
158 2971410450 2971403814 Bacteria 7370929
159 2971514465 2971511577 Bacteria 5404012
160 2980130311 2980125574 Bacteria 5567337
161 2980180677 2980176882 Bacteria 5397533
162 2981287165 2981284811 Bacteria 4641497
163 2981292113 2981289755 Bacteria 4641509
164 2981982795 2981980479 Bacteria 4641628
165 2981987415 2981985349 Bacteria 4641497
166 2984531220 2984527788 Bacteria 5288478
167 2984537330 2984532647 Bacteria 5288506
168 2996707005 2996706504 Bacteria 5757485
169 3001120881 3001119090 Bacteria 3449530
170 648172239 648028048 Bacteria 5394884
171 8002317724 8002317523 Bacteria 8051857
172 8046997123 8046991243 Bacteria 8497463
173 8054471372 8054465665 Bacteria 7323556
174 8057345801 8057345674 Bacteria 4160394
175 Ga0496120_0018884
176 Ga0055538_1000114
177 Ga0055538_1000617
178 Ga0055541_1000286
179 Ga0070680_100000042
180 Ga0070660_100014018
181 Ga0070714_100042717
182 Ga0070681_10000056
183 Ga0070679_100000140
184 Ga0081455_10003814
185 Ga0081455_10217038
186 Ga0075364_10207594
187 Ga0075362_10000173
188 Ga0075362_10058124
189 Ga0075369_10007213
190 Ga0075428_100001136
191 Ga0105244_10017088
192 Ga0111539_10023380
193 Ga0105237_10000018
194 Ga0105238_10100496
195 Ga0105246_10001767
196 Ga0213876_10071127
197 Ga0209784_100075
198 Ga0209566_100091
199 Ga0209566_104311
200 Ga0209437_100449
201 Ga0209675_1016126
202 Ga0209025_1000946
203 Ga0207655_1006125
204 Ga0207655_1031088
205 Ga0207707_10000196
206 Ga0207671_10000049
207 Ga0207660_10000101
208 Ga0207657_10021260
209 Ga0207652_10000110
210 Ga0207694_10067578
211 Ga0207664_10013933
212 Ga0207428_10120620
213 Ga0316576_10096568
214 Ga0395899_0002037
215 Ga0395899_0035776
216 Ga0436365_0277839
217 Ga0436363_0575584
218 Ga0453683_0033272
219 Ga0453684_0000814
220 Ga0466958_0045453
221 Ga0466967_0240468
222 Ga0466967_0683407
223 Ga0495590_0012984
224 Ga0496114_0000972
225 Ga0496116_0023901
226 Ga0496117_0000084
227 Ga0496117_0000344
228 Ga0496117_0149463
229 Ga0496118_0074276
230 Ga0496118_0197045
231 Ga0496119_0000231
232 Ga0496119_0048628
233 Ga0496120_0000574
234 Ga0496120_0000677
235 Ga0496120_0005057
236 Ga0496120_0036277
237 Ga0496121_0004014
238 Ga0496121_0093495
239 Ga0496121_0096990
240 Ga0496121_0186076
241 Ga0496121_0240178
242 Ga0496122_0000314
243 Ga0496122_0002241
244 Ga0496122_0006058
245 Ga0496122_0095728
246 Ga0496122_0122889
247 Ga0496122_0137770
248 Ga0496123_0003281
249 Ga0496123_0009091
250 Ga0496124_0017155
251 Ga0496124_0143345
252 Ga0496125_0000556
253 Ga0496125_0002025
254 Ga0496125_0272292
255 Ga0496126_0000060
256 Ga0496126_0005818
257 Ga0496126_0070125
258 Ga0496126_0086456
259 Ga0501309_000176
260 Ga0501034_0149455
261 Ga0501036_0130828
262 Ga0501039_0143613
263 Ga0501042_0163134
264 Ga0501042_0178220
265 Ga0501046_0216017
266 Ga0501048_0108620
267 Ga0501069_0135852
268 Ga0501070_0049253
269 Ga0501071_0075275
270 Ga0501071_0114793
271 Ga0501071_0118515
272 Ga0501072_0156131
273 Ga0501074_0211905
274 Ga0501075_0115584
275 Ga0501076_0058321
276 Ga0501076_0060062
277 Ga0501076_0485376
278 Ga0501079_0260976
279 Ga0501080_0133147
280 Ga0501081_0165927
281 Ga0501083_0203104
282 Ga0501045_0424257
283 nmdc:mga03683_225_c1
284 nmdc:mga03683_71152_c1
285 nmdc:mga03683_71893_c1
286 nmdc:mga00v17_225632_c1
287 nmdc:mga08y16_229600_c1
288 Ga0500651_0186728
289 Ga0500559_0000163
290 Ga0500616_0000403
291 Ga0501084_0495182
292 Ga0530510_0151342
293 2512730023
294 2548698596
295 2563930273
296 2578338943
297 2580934632
298 2621277399
299 2643736862
300 2723606245
301 2728531389
302 2730136868
303 2738887241
304 2753039107
305 2753327618
306 2753808566
307 2802438131
308 2821118165
309 2864739591
310 2881638117
311 2885529871
312 2888579633
313 2888579651
314 2889048058
315 2889051731
316 2889276797
317 2889299754
318 2904117200
319 2904168100
320 2904494327
321 2904596514
322 2907207357
323 2919165165
324 2919425724
325 2919719266
326 2931385164
327 2939680670
328 2939706744
329 2945996205
330 2946058895
331 2956941193
332 2971410450
333 2971514465
334 2980130311
335 2980180677
336 2981287165
337 2981292113
338 2981982795
339 2981987415
340 2984531220
341 2984537330
342 2996707005
343 3001120881
344 648172239
345 8002317724
346 8046997123
347 8054471372
348 8057345801

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04321

RmlD_sub_bind

RmlD substrate binding domain

30

316

0.98

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

32

240

0.87

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

62

275

0.85

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

60

191

0.82

PF07993

NAD_binding_4

Male sterility protein

68

219

0.78

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

50

223

0.73

PF13460

NAD_binding_10

NAD(P)H-binding

36

229

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sc6-assembly6.cif.gz_F 2.65 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose reductase (rfbd) from bacillus anthracis str. ames in complex with nadp 0.9835 2 284
3sc6-assembly5.cif.gz_E 2.65 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose reductase (rfbd) from bacillus anthracis str. ames in complex with nadp 0.9821 2 284
3sc6-assembly2.cif.gz_B 2.65 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose reductase (rfbd) from bacillus anthracis str. ames in complex with nadp 0.9782 2 284
1vl0-assembly1.cif.gz_B crystal structure of a dtdp-4-dehydrorhamnose reductase, rfbd ortholog (ca_c2315) from clostridium acetobutylicum atcc 824 at 2.05 a resolution 0.9734 1 287
1vl0-assembly1.cif.gz_B crystal structure of a dtdp-4-dehydrorhamnose reductase, rfbd ortholog (ca_c2315) from clostridium acetobutylicum atcc 824 at 2.05 a resolution 0.9666 1 287
ID Description Score Start End Superfamily
1vl0B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9806 3 209 3.40.50.720
3sc6D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.979 2 272 3.40.50.720
3sc6D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.951 2 272 3.40.50.720
4wpgA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9414 2 210 3.40.50.720
1kc0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9321 1 285 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A357D7T4-F1-model_v4 dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133) 0.9972 42 133 GO:0005829
GO:0008831
GO:0019305
GO:0045226
AF-A0A7C1TNK7-F1-model_v4 dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133) 0.996 1 133 GO:0005829
GO:0008831
GO:0019305
GO:0045226
AF-W3YMN7-F1-model_v4 deleted 0.9937 35 166
AF-A0A7V9KSM7-F1-model_v4 dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133) 0.9933 1 143 GO:0005829
GO:0008831
GO:0019305
GO:0045226
AF-A0A7V4MTA4-F1-model_v4 dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133) 0.991 34 179 GO:0005829
GO:0008831
GO:0019305
GO:0045226

Map