F264844

General Info

Members Datasets Scaffolds Average Seq Length
174 142 348 288

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10506487|Ga0307406_105064871
Length 257
Sequence MTSTQILETPAASLAYDVHGPLPTADGRPPLLLIGHPMDAGGFATLAELLPDRTVVTYDPRGLGRSSRHDGRSERTPEDNADDVHRIIAEIGGPVDLFLLALLPDADRAFAAERDVQAAYHDKGWGHGMAAFIALTSWQGEFPHESPAAPDPAAFGLPVEDNGSRDDPLLSGVSNAVTAYEPDIAAVQAAPTRVVVAVGEESQNLCTGRTSAALAEALGQEAVVFPGGHGGFMGGEFGYQGQPDAFAKRLREVLDTK

Samples

Sample ID Description Type Environment
1 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
59 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
60 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
61 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
62 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
63 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
67 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
68 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
69 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
70 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
71 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
72 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
73 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
74 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
75 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
76 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
77 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
78 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
79 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
80 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
81 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
82 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
83 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
84 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
85 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
86 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
87 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
88 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
89 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
90 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
91 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
92 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
93 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
94 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
95 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
96 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
97 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
98 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
99 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
100 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
101 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
102 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
103 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
104 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
105 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
110 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
111 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
112 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
113 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
114 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
115 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
116 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
117 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
118 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
119 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
120 2582580736 Prauserella sp. Am3 Isolate Unclassified
121 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
122 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
123 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
124 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
125 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
126 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
127 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
128 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
129 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
130 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
131 2858882152 Micromonospora noduli MED15 Isolate Nodule
132 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
133 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
134 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
135 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
136 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
137 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
138 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
139 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
140 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
141 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
142 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.78
Metatranscriptomes 0
Isolates 13.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.87
Nodule 1.15
Rhizoplane 9.77
Rhizosphere 68.39
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307406_10506487 3300031901 Bacteria 980
2 JGI25406J46586_10008679 3300003203 Bacteria 4584
3 Ga0065714_10071451 3300005288 Bacteria 3564
4 Ga0070683_100005614 3300005329 Bacteria 10483
5 Ga0070683_100142739 3300005329 Bacteria 2268
6 Ga0070682_100031688 3300005337 Bacteria 3198
7 Ga0070687_100208625 3300005343 Bacteria 1188
8 Ga0070692_10046740 3300005345 Bacteria 2238
9 Ga0070668_100001845 3300005347 Bacteria 15440
10 Ga0070668_100396199 3300005347 Bacteria 1178
11 Ga0070668_100410419 3300005347 Bacteria 1158
12 Ga0070668_100531884 3300005347 Bacteria 1021
13 Ga0070671_100004519 3300005355 Bacteria 11015
14 Ga0070700_100002817 3300005441 Bacteria 8915
15 Ga0070663_100000772 3300005455 Bacteria 17456
16 Ga0068867_100042558 3300005459 Bacteria 3323
17 Ga0070685_10214538 3300005466 Bacteria 1258
18 Ga0070665_100002641 3300005548 Bacteria 19515
19 Ga0070665_100154077 3300005548 Bacteria 2300
20 Ga0070665_100700085 3300005548 Bacteria 1026
21 Ga0068852_100072416 3300005616 Bacteria 3028
22 Ga0068864_100408892 3300005618 Bacteria 1291
23 Ga0068861_100336135 3300005719 Bacteria 1320
24 Ga0068870_10018213 3300005840 Bacteria 3388
25 Ga0068863_100099227 3300005841 Bacteria 2767
26 Ga0068860_100012559 3300005843 Bacteria 8338
27 Ga0081539_10000162 3300005985 Bacteria 156292
28 Ga0075365_10207972 3300006038 Bacteria 1372
29 Ga0075364_10114889 3300006051 Bacteria 1799
30 Ga0075364_10256103 3300006051 Bacteria 1189
31 Ga0068871_100185443 3300006358 Bacteria 1790
32 Ga0075428_100495010 3300006844 Bacteria 1308
33 Ga0068865_100038780 3300006881 Bacteria 3226
34 Ga0111539_10049634 3300009094 Bacteria 5003
35 Ga0105245_10049489 3300009098 Bacteria 3764
36 Ga0114129_11035923 3300009147 Bacteria 1031
37 Ga0105248_10337052 3300009177 Bacteria 1698
38 Ga0105249_10569691 3300009553 Bacteria 1185
39 Ga0157375_10573889 3300013308 Bacteria 1288
40 Ga0163163_10325292 3300014325 Bacteria 1591
41 Ga0157377_10011913 3300014745 Bacteria 4356
42 Ga0157379_10009265 3300014968 Bacteria 8573
43 Ga0207688_10026954 3300025901 Bacteria 3161
44 Ga0207643_10006659 3300025908 Bacteria 6195
45 Ga0207687_10104412 3300025927 Bacteria 2092
46 Ga0207644_10007059 3300025931 Bacteria 7318
47 Ga0207704_10459551 3300025938 Bacteria 1018
48 Ga0207691_10000938 3300025940 Bacteria 28954
49 Ga0207711_10089311 3300025941 Bacteria 2707
50 Ga0207661_10004427 3300025944 Bacteria 9858
51 Ga0207661_10385880 3300025944 Bacteria 1268
52 Ga0207679_10045521 3300025945 Bacteria 3174
53 Ga0207668_10120882 3300025972 Bacteria 1983
54 Ga0207677_10143778 3300026023 Bacteria 1830
55 Ga0207678_10008050 3300026067 Bacteria 9295
56 Ga0207708_10000683 3300026075 Bacteria 25782
57 Ga0207641_10076379 3300026088 Bacteria 2896
58 Ga0207648_10001487 3300026089 Bacteria 25804
59 Ga0207676_10528554 3300026095 Bacteria 1124
60 Ga0207675_100001224 3300026118 Bacteria 25629
61 Ga0207698_10018087 3300026142 Bacteria 4796
62 Ga0207428_10351258 3300027907 Bacteria 1085
63 Ga0268266_10094556 3300028379 Bacteria 2623
64 Ga0268266_10149331 3300028379 Bacteria 2105
65 Ga0268266_10361025 3300028379 Bacteria 1367
66 Ga0268265_10326226 3300028380 Bacteria 1393
67 Ga0268264_10028730 3300028381 Bacteria 4551
68 Ga0307513_10015972 3300031456 Bacteria 9080
69 Ga0307408_100302296 3300031548 Bacteria 1341
70 Ga0307514_10141533 3300031649 Bacteria 1634
71 Ga0307413_10154717 3300031824 Bacteria 1602
72 Ga0307410_10018676 3300031852 Bacteria 4195
73 Ga0307410_10069822 3300031852 Bacteria 2431
74 Ga0307406_10000648 3300031901 Bacteria 19779
75 Ga0307406_10001084 3300031901 Bacteria 15146
76 Ga0307406_10053231 3300031901 Bacteria 2577
77 Ga0307406_10292585 3300031901 Bacteria 1247
78 Ga0307407_10030751 3300031903 Bacteria 2900
79 Ga0307409_100019004 3300031995 Bacteria 4640
80 Ga0307416_100035875 3300032002 Bacteria 3794
81 Ga0307416_100036812 3300032002 Bacteria 3758
82 Ga0307416_100822641 3300032002 Bacteria 1026
83 Ga0307414_10016968 3300032004 Bacteria 4444
84 Ga0307414_10178574 3300032004 Bacteria 1705
85 Ga0307415_100035241 3300032126 Bacteria 3267
86 Ga0307415_100447773 3300032126 Bacteria 1115
87 Ga0373946_0017599 3300035171 Bacteria 2736
88 Ga0436364_0451944 3300037853 Bacteria 3947
89 Ga0436364_0948511 3300037853 Bacteria 1031
90 Ga0436363_1174329 3300039450 Bacteria 2722
91 Ga0451835_0062986 3300041492 Bacteria 1055
92 Ga0451837_0484098 3300041494 Bacteria 1165
93 Ga0466964_0026407 3300044706 Bacteria 2273
94 Ga0466971_0037817 3300044719 Bacteria 2164
95 Ga0466970_0048781 3300044765 Bacteria 2258
96 Ga0466957_0008255 3300044842 Bacteria 5917
97 Ga0466957_0223189 3300044842 Bacteria 1245
98 Ga0466960_0098643 3300044901 Bacteria 1501
99 Ga0466958_0117260 3300045836 Bacteria 1665
100 Ga0466967_0003856 3300045976 Bacteria 9932
101 Ga0466967_0281499 3300045976 Bacteria 1596
102 Ga0495631_0102923 3300046518 Bacteria 1229
103 Ga0495666_0145732 3300046526 Bacteria 1102
104 Ga0495645_0154136 3300046543 Bacteria 1593
105 Ga0495658_0298540 3300046683 Bacteria 1018
106 Ga0495686_0078207 3300047472 Bacteria 2025
107 Ga0496100_0045037 3300048903 Bacteria 2829
108 Ga0496101_0006452 3300048904 Bacteria 7548
109 Ga0496104_0029358 3300048907 Bacteria 5100
110 Ga0496104_0237057 3300048907 Bacteria 1736
111 Ga0496105_0023474 3300048908 Bacteria 5003
112 Ga0496105_0144414 3300048908 Bacteria 1957
113 Ga0496107_0123768 3300048910 Bacteria 1906
114 Ga0496108_0000054 3300048911 Bacteria 125333
115 Ga0496109_0040389 3300048912 Bacteria 4226
116 Ga0496109_0158629 3300048912 Bacteria 2119
117 Ga0496109_0453078 3300048912 Bacteria 1212
118 Ga0496111_0100620 3300048914 Bacteria 2123
119 Ga0496114_0003033 3300048917 Bacteria 12879
120 Ga0496114_0068523 3300048917 Bacteria 2979
121 Ga0496114_0422520 3300048917 Bacteria 1181
122 Ga0496114_0834723 3300048917 Bacteria 801
123 Ga0496115_0073995 3300048918 Bacteria 2766
124 Ga0496117_0001897 3300048920 Bacteria 28066
125 Ga0496118_0110510 3300048921 Bacteria 1825
126 Ga0496119_0009892 3300048922 Bacteria 8099
127 Ga0496120_0008301 3300048923 Bacteria 7573
128 Ga0496121_0005814 3300048924 Bacteria 15638
129 Ga0496122_0021643 3300048925 Bacteria 5747
130 Ga0496123_0155789 3300048926 Bacteria 1225
131 Ga0496124_0006017 3300048927 Bacteria 13376
132 Ga0496125_0004665 3300048928 Bacteria 15628
133 Ga0496125_0016884 3300048928 Bacteria 6988
134 Ga0496125_0018755 3300048928 Bacteria 6557
135 Ga0496126_0014619 3300048929 Bacteria 7926
136 Ga0501031_0041084 3300049568 Bacteria 3020
137 Ga0501036_0033018 3300049572 Bacteria 4376
138 Ga0501038_0260991 3300049574 Bacteria 1369
139 Ga0501047_0577746 3300049581 Bacteria 947
140 Ga0501071_0015869 3300049587 Bacteria 5173
141 Ga0501072_0088086 3300049588 Bacteria 2463
142 Ga0501076_0048473 3300049592 Bacteria 3358
143 Ga0501079_0148118 3300049741 Bacteria 1830
144 Ga0501080_0450891 3300049742 Bacteria 1153
145 Ga0501081_0034435 3300049743 Bacteria 3446
146 Ga0501045_0120359 3300049824 Bacteria 1949
147 nmdc:mga00v17_92165_c1 3300050491 Bacteria 1904
148 nmdc:mga0yw44_157668_c1 3300050492 Bacteria 1484
149 nmdc:mga08y16_220714_c1 3300050511 Bacteria 1963
150 nmdc:mga08y16_330351_c1 3300050511 Bacteria 1568
151 Ga0530510_0202796 3300061734 Bacteria 1474
152 2583151667 2582580736 Bacteria 5325865
153 2623502049 2622736605 Bacteria 4992138
154 2644678705 2643221724 Bacteria 3593515
155 2730228208 2728369380 Bacteria 3620317
156 2747955326 2747842429 Bacteria 3914386
157 2772642998 2772190715 Bacteria 6959372
158 2819691571 2818991462 Bacteria 4320267
159 2852680539 2852677369 Bacteria 3768884
160 2855673026 2855670206 Bacteria 7120389
161 2857293783 2857288857 Bacteria 7189066
162 2857725622 2857723135 Bacteria 4217853
163 2858884407 2858882152 Bacteria 7230291
164 2858896797 2858895516 Bacteria 7378898
165 2862995947 2862993130 Bacteria 3860849
166 2869063002 2869061728 Bacteria 7112407
167 2869069169 2869068681 Bacteria 7205615
168 2880491862 2880489317 Bacteria 7096270
169 2880500439 2880495981 Bacteria 7340502
170 2929228949 2929226422 Bacteria 7248583
171 2939661264 2939660829 Bacteria 3784848
172 2946081940 2946080515 Bacteria 4310960
173 8003831106 8003830390 Bacteria 6541657
174 8003873767 8003870546 Bacteria 7396674
175 Ga0307406_10506487
176 JGI25406J46586_10008679
177 Ga0065714_10071451
178 Ga0070683_100005614
179 Ga0070683_100142739
180 Ga0070682_100031688
181 Ga0070687_100208625
182 Ga0070692_10046740
183 Ga0070668_100001845
184 Ga0070668_100396199
185 Ga0070668_100410419
186 Ga0070668_100531884
187 Ga0070671_100004519
188 Ga0070700_100002817
189 Ga0070663_100000772
190 Ga0068867_100042558
191 Ga0070685_10214538
192 Ga0070665_100002641
193 Ga0070665_100154077
194 Ga0070665_100700085
195 Ga0068852_100072416
196 Ga0068864_100408892
197 Ga0068861_100336135
198 Ga0068870_10018213
199 Ga0068863_100099227
200 Ga0068860_100012559
201 Ga0081539_10000162
202 Ga0075365_10207972
203 Ga0075364_10114889
204 Ga0075364_10256103
205 Ga0068871_100185443
206 Ga0075428_100495010
207 Ga0068865_100038780
208 Ga0111539_10049634
209 Ga0105245_10049489
210 Ga0114129_11035923
211 Ga0105248_10337052
212 Ga0105249_10569691
213 Ga0157375_10573889
214 Ga0163163_10325292
215 Ga0157377_10011913
216 Ga0157379_10009265
217 Ga0207688_10026954
218 Ga0207643_10006659
219 Ga0207687_10104412
220 Ga0207644_10007059
221 Ga0207704_10459551
222 Ga0207691_10000938
223 Ga0207711_10089311
224 Ga0207661_10004427
225 Ga0207661_10385880
226 Ga0207679_10045521
227 Ga0207668_10120882
228 Ga0207677_10143778
229 Ga0207678_10008050
230 Ga0207708_10000683
231 Ga0207641_10076379
232 Ga0207648_10001487
233 Ga0207676_10528554
234 Ga0207675_100001224
235 Ga0207698_10018087
236 Ga0207428_10351258
237 Ga0268266_10094556
238 Ga0268266_10149331
239 Ga0268266_10361025
240 Ga0268265_10326226
241 Ga0268264_10028730
242 Ga0307513_10015972
243 Ga0307408_100302296
244 Ga0307514_10141533
245 Ga0307413_10154717
246 Ga0307410_10018676
247 Ga0307410_10069822
248 Ga0307406_10000648
249 Ga0307406_10001084
250 Ga0307406_10053231
251 Ga0307406_10292585
252 Ga0307407_10030751
253 Ga0307409_100019004
254 Ga0307416_100035875
255 Ga0307416_100036812
256 Ga0307416_100822641
257 Ga0307414_10016968
258 Ga0307414_10178574
259 Ga0307415_100035241
260 Ga0307415_100447773
261 Ga0373946_0017599
262 Ga0436364_0451944
263 Ga0436364_0948511
264 Ga0436363_1174329
265 Ga0451835_0062986
266 Ga0451837_0484098
267 Ga0466964_0026407
268 Ga0466971_0037817
269 Ga0466970_0048781
270 Ga0466957_0008255
271 Ga0466957_0223189
272 Ga0466960_0098643
273 Ga0466958_0117260
274 Ga0466967_0003856
275 Ga0466967_0281499
276 Ga0495631_0102923
277 Ga0495666_0145732
278 Ga0495645_0154136
279 Ga0495658_0298540
280 Ga0495686_0078207
281 Ga0496100_0045037
282 Ga0496101_0006452
283 Ga0496104_0029358
284 Ga0496104_0237057
285 Ga0496105_0023474
286 Ga0496105_0144414
287 Ga0496107_0123768
288 Ga0496108_0000054
289 Ga0496109_0040389
290 Ga0496109_0158629
291 Ga0496109_0453078
292 Ga0496111_0100620
293 Ga0496114_0003033
294 Ga0496114_0068523
295 Ga0496114_0422520
296 Ga0496114_0834723
297 Ga0496115_0073995
298 Ga0496117_0001897
299 Ga0496118_0110510
300 Ga0496119_0009892
301 Ga0496120_0008301
302 Ga0496121_0005814
303 Ga0496122_0021643
304 Ga0496123_0155789
305 Ga0496124_0006017
306 Ga0496125_0004665
307 Ga0496125_0016884
308 Ga0496125_0018755
309 Ga0496126_0014619
310 Ga0501031_0041084
311 Ga0501036_0033018
312 Ga0501038_0260991
313 Ga0501047_0577746
314 Ga0501071_0015869
315 Ga0501072_0088086
316 Ga0501076_0048473
317 Ga0501079_0148118
318 Ga0501080_0450891
319 Ga0501081_0034435
320 Ga0501045_0120359
321 nmdc:mga00v17_92165_c1
322 nmdc:mga0yw44_157668_c1
323 nmdc:mga08y16_220714_c1
324 nmdc:mga08y16_330351_c1
325 Ga0530510_0202796
326 2583151667
327 2623502049
328 2644678705
329 2730228208
330 2747955326
331 2772642998
332 2819691571
333 2852680539
334 2855673026
335 2857293783
336 2857725622
337 2858884407
338 2858896797
339 2862995947
340 2869063002
341 2869069169
342 2880491862
343 2880500439
344 2929228949
345 2939661264
346 2946081940
347 8003831106
348 8003873767

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xmd-assembly2.cif.gz_B crystal structure of epoxide hydrolase vreh1 from vigna radiata 0.8675 5 128
6ty7-assembly1.cif.gz_A crystal structure of haloalkane dehalogenase variant dhaa115 domain-swapped dimer type-1 0.8343 6 125
8b6o-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 0.8324 6 125
6xtc-assembly2.cif.gz_D crystal structure of haloalkane dehalogenase variant dhaa177 domain-swapped dimer type-3 0.8319 6 125
8b6p-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.8286 6 125
ID Description Score Start End Superfamily
af_A0A0R4IK35_1_258_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9025 84 126 3.40.50.1820
af_Q9D379_48_454_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8641 4 126 3.40.50.1820
af_Q9NQF3_11_190_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8607 6 122 3.40.50.1820
af_Q4CQ94_14_186_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8516 15 125 3.40.50.12270
af_Q54CU1_1_267_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8512 19 122 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7K0CWU2-F1-model_v4 Alpha/beta hydrolase 0.9895 110 292
AF-K0ENF1-F1-model_v4 Hydrolase 0.9892 6 291 GO:0016787
AF-A0A845J666-F1-model_v4 Alpha/beta fold hydrolase 0.9862 36 289 GO:0016020
GO:0016787
AF-K0ENF1-F1-model_v4 Hydrolase 0.9823 6 291 GO:0016787
AF-A0A7K0CWU2-F1-model_v4 Alpha/beta hydrolase 0.9789 110 292

Map