F264774

General Info

Members Datasets Scaffolds Average Seq Length
174 128 172 209

Family's Representative Sequence

Representative Sequence 3300028786|Ga0307517_10221885|Ga0307517_102218852
Length 230
Sequence MCVRDLPASEEDGDRAEFARGGKHYSSPVTADHYFSAEPAAPAKAGTIEFSVAGHDYALEVASGVFSAGRLDPGTAVLLRKADLPTVATAGDLLDLGCGYGPIACVLATEAPKASVYAVDVNARARELAGANAARLGLPIQVSAPDEVPADLTFAEIWSNPPTHVGKAELHSLLERWLPRLAPGGVAWLVINKHLGGDSLHAWLVSLGWDVRRVASQRGFRVLRVTGKTD

Samples

Sample ID Description Type Environment
1 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
14 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
15 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
16 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
22 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
24 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
25 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
26 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
27 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
40 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
41 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
42 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
43 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
44 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
45 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
46 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
47 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
48 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
49 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
50 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
51 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
52 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
53 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
54 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
55 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
56 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
57 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
58 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
59 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
60 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
61 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
62 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
63 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
64 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
65 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
66 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
67 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
68 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
69 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
70 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
71 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
72 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
73 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
75 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
76 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
77 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
78 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
79 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
80 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
81 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
82 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
83 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
84 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
85 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
86 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
87 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
88 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
89 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
90 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
91 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
92 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
93 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
94 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
95 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
96 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
97 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
98 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
99 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
100 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
101 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
102 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
103 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
104 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
105 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
106 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
109 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
110 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
111 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
112 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
116 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
117 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
118 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
119 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
120 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
121 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
122 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
123 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
124 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
125 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
126 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
127 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
128 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 0
Isolates 1.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.02
Nodule 0
Rhizoplane 6.32
Rhizosphere 71.84
Stem 0
Stem Tuber 0
Unclassified 17.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10029511 3300003203 Bacteria 2075
2 rootH1_10054933 3300003316 Bacteria 1362
3 rootH1_10129639 3300003316 Bacteria 1685
4 rootH2_10003046 3300003320 Bacteria 2848
5 rootL2_10079336 3300003322 Bacteria 1684
6 rootL2_10103528 3300003322 Bacteria 1716
7 rootL2_10266955 3300003322 Bacteria 1158
8 Ga0070683_100000178 3300005329 Bacteria 42148
9 Ga0068868_101008738 3300005338 Bacteria 762
10 Ga0070668_100000729 3300005347 Bacteria 22546
11 Ga0070667_100017797 3300005367 Bacteria 5890
12 Ga0070714_100204148 3300005435 Bacteria 1809
13 Ga0070713_100162816 3300005436 Bacteria 1992
14 Ga0070684_100005794 3300005535 Bacteria 9504
15 Ga0070684_100148625 3300005535 Bacteria 2121
16 Ga0068852_100401788 3300005616 Bacteria 1348
17 Ga0068864_100005930 3300005618 Bacteria 10017
18 Ga0068864_100264181 3300005618 Bacteria 1602
19 Ga0068866_10082289 3300005718 Bacteria 1732
20 Ga0068858_100157748 3300005842 Bacteria 2135
21 Ga0068858_100606330 3300005842 Bacteria 1062
22 Ga0081539_10001279 3300005985 Bacteria 44286
23 Ga0081539_10003532 3300005985 Bacteria 19014
24 Ga0075428_100000164 3300006844 Bacteria 61044
25 Ga0075428_100110272 3300006844 Bacteria 2998
26 Ga0075428_100294337 3300006844 Bacteria 1746
27 Ga0075430_100616416 3300006846 Bacteria 895
28 Ga0075431_100252860 3300006847 Bacteria 1790
29 Ga0105247_10533244 3300009101 Bacteria 860
30 Ga0114129_10000114 3300009147 Bacteria 80730
31 Ga0114129_10712036 3300009147 Bacteria 1289
32 Ga0105248_10113585 3300009177 Bacteria 3055
33 Ga0105248_10320109 3300009177 Bacteria 1747
34 Ga0157374_11276042 3300013296 Bacteria 756
35 Ga0163163_10030261 3300014325 Bacteria 5215
36 Ga0157379_10142495 3300014968 Bacteria 2161
37 Ga0157379_10237647 3300014968 Bacteria 1652
38 Ga0207700_10439231 3300025928 Bacteria 1149
39 Ga0207711_10068038 3300025941 Bacteria 3084
40 Ga0207711_10113612 3300025941 Bacteria 2411
41 Ga0207661_10002728 3300025944 Bacteria 12148
42 Ga0207668_10000539 3300025972 Bacteria 23787
43 Ga0207658_10667001 3300025986 Bacteria 938
44 Ga0207703_10069946 3300026035 Bacteria 2896
45 Ga0207702_10650292 3300026078 Bacteria 1037
46 Ga0207641_10624783 3300026088 Bacteria 1056
47 Ga0207676_10007273 3300026095 Bacteria 7844
48 Ga0207674_10168891 3300026116 Bacteria 2141
49 Ga0207683_10150570 3300026121 Bacteria 2100
50 Ga0268266_11001636 3300028379 Bacteria 809
51 Ga0307517_10077268 3300028786 Bacteria 2895
52 Ga0307517_10221885 3300028786 Bacteria 1148
53 Ga0307515_10001812 3300028794 Bacteria 47673
54 Ga0307515_10052633 3300028794 Bacteria 6032
55 Ga0307515_10101839 3300028794 Bacteria 3461
56 Ga0307515_10108372 3300028794 Bacteria 3273
57 Ga0307511_10166442 3300030521 Bacteria 1223
58 Ga0307512_10010661 3300030522 Bacteria 8744
59 Ga0307512_10057739 3300030522 Bacteria 3030
60 Ga0307513_10000007 3300031456 Bacteria 451043
61 Ga0307509_10031033 3300031507 Bacteria 5906
62 Ga0307508_10028153 3300031616 Bacteria 5083
63 Ga0307508_10030740 3300031616 Bacteria 4853
64 Ga0307508_10064611 3300031616 Bacteria 3226
65 Ga0307508_10130917 3300031616 Bacteria 2112
66 Ga0307508_10488748 3300031616 Bacteria 825
67 Ga0307514_10271529 3300031649 Bacteria 981
68 Ga0307514_10374800 3300031649 Bacteria 743
69 Ga0307516_10013922 3300031730 Bacteria 8535
70 Ga0307516_10036773 3300031730 Bacteria 4898
71 Ga0307516_10046233 3300031730 Bacteria 4296
72 Ga0307516_10051103 3300031730 Bacteria 4053
73 Ga0307405_10059562 3300031731 Bacteria 2407
74 Ga0307405_10077765 3300031731 Bacteria 2157
75 Ga0307413_10055634 3300031824 Bacteria 2409
76 Ga0326468_10000956 3300031889 Bacteria 2789
77 Ga0307406_10004670 3300031901 Bacteria 7462
78 Ga0307406_10034335 3300031901 Bacteria 3111
79 Ga0307406_10437233 3300031901 Bacteria 1046
80 Ga0307406_10467327 3300031901 Bacteria 1016
81 Ga0307407_10058297 3300031903 Bacteria 2244
82 Ga0307412_10477835 3300031911 Bacteria 1033
83 Ga0307409_100008694 3300031995 Bacteria 6183
84 Ga0307409_100362419 3300031995 Bacteria 1372
85 Ga0307409_100711643 3300031995 Bacteria 1004
86 Ga0307416_100111379 3300032002 Bacteria 2413
87 Ga0307416_100575720 3300032002 Bacteria 1202
88 Ga0307416_100858553 3300032002 Bacteria 1006
89 Ga0307414_10467365 3300032004 Bacteria 1110
90 Ga0307414_11233876 3300032004 Bacteria 693
91 Ga0307411_10202846 3300032005 Bacteria 1525
92 Ga0307507_10105895 3300033179 Bacteria 2325
93 Ga0373938_0047749 3300034957 Bacteria 969
94 Ga0373940_0000542 3300035088 Bacteria 5958
95 Ga0373951_0000028 3300035091 Bacteria 58335
96 Ga0373923_0027016 3300035111 Bacteria 2287
97 Ga0373939_0069854 3300035114 Bacteria 1141
98 Ga0373941_0095163 3300035115 Bacteria 1028
99 Ga0373953_0032861 3300035117 Bacteria 2027
100 Ga0373954_0015862 3300035118 Bacteria 3370
101 Ga0373957_0064174 3300035120 Bacteria 1427
102 Ga0373943_0113293 3300035170 Bacteria 1433
103 Ga0373946_0027576 3300035171 Bacteria 2248
104 Ga0373955_0210779 3300035172 Bacteria 1158
105 Ga0373942_0000550 3300035207 Bacteria 10555
106 Ga0373962_0005353 3300035242 Bacteria 3106
107 Ga0373935_0206373 3300035692 Bacteria 1360
108 Ga0373935_0249847 3300035692 Bacteria 1241
109 Ga0373947_0152934 3300035725 Bacteria 1487
110 Ga0373925_0115257 3300037068 Bacteria 2080
111 Ga0373925_0185008 3300037068 Bacteria 1651
112 Ga0373925_0571388 3300037068 Bacteria 930
113 Ga0436364_0117530 3300037853 Bacteria 1537
114 Ga0451791_1520341 3300041451 Bacteria 1248
115 Ga0439463_008591 3300042016 Bacteria 2516
116 Ga0439458_0037560 3300042157 Bacteria 1168
117 Ga0466967_0000204 3300045976 Bacteria 24854
118 Ga0495629_0058376 3300046459 Bacteria 2698
119 Ga0495629_0251502 3300046459 Bacteria 1216
120 Ga0495651_0004613 3300046462 Bacteria 10534
121 Ga0495653_0106500 3300046463 Bacteria 2022
122 Ga0495662_0024768 3300046476 Bacteria 2896
123 Ga0495664_0070586 3300046477 Bacteria 2086
124 Ga0495664_0228352 3300046477 Bacteria 1126
125 Ga0495628_0073226 3300046516 Bacteria 2669
126 Ga0495632_0147845 3300046519 Bacteria 1087
127 Ga0495652_0027559 3300046529 Bacteria 5004
128 Ga0495652_0133751 3300046529 Bacteria 1959
129 Ga0495665_0499603 3300046531 Bacteria 613
130 Ga0495640_0061915 3300046533 Bacteria 2540
131 Ga0495640_0093352 3300046533 Bacteria 1983
132 Ga0495587_0018981 3300046536 Bacteria 4261
133 Ga0495645_0023054 3300046543 Bacteria 4506
134 Ga0495645_0089953 3300046543 Bacteria 2195
135 Ga0495667_0018570 3300046559 Bacteria 4695
136 Ga0495635_0067952 3300046663 Bacteria 2444
137 Ga0495657_0014837 3300046675 Bacteria 5717
138 Ga0495599_0377695 3300046678 Bacteria 846
139 Ga0495613_0349883 3300046689 Bacteria 1015
140 Ga0495600_0100572 3300046809 Bacteria 1884
141 Ga0495674_0004688 3300047319 Bacteria 13148
142 Ga0495674_0130771 3300047319 Bacteria 2115
143 Ga0495680_0015228 3300047322 Bacteria 6640
144 Ga0495684_0007758 3300047471 Bacteria 8308
145 Ga0495684_0151290 3300047471 Bacteria 1735
146 Ga0495593_0276583 3300047673 Bacteria 840
147 Ga0496101_0122308 3300048904 Bacteria 1969
148 Ga0496104_0016129 3300048907 Bacteria 6781
149 Ga0496105_0016440 3300048908 Bacteria 5909
150 Ga0496108_0000043 3300048911 Bacteria 146005
151 Ga0496108_0149300 3300048911 Bacteria 2016
152 Ga0496109_0071092 3300048912 Bacteria 3194
153 Ga0496110_0137640 3300048913 Bacteria 2207
154 Ga0496111_0046579 3300048914 Bacteria 3122
155 Ga0496112_0074237 3300048915 Bacteria 3362
156 Ga0496113_0017490 3300048916 Bacteria 4977
157 Ga0501033_0000149 3300049570 Bacteria 67717
158 Ga0501040_0361874 3300049576 Bacteria 1040
159 Ga0501044_0001504 3300049823 Bacteria 27335
160 nmdc:mga05p37_106173_c1 3300050507 Bacteria 3455
161 nmdc:mga0qj67_658288_c1 3300050509 Bacteria 835
162 nmdc:mga06r32_126190_c1 3300050510 Bacteria 2528
163 Ga0495601_0242800 3300053077 Bacteria 1176
164 Ga0495619_0072627 3300053085 Bacteria 2305
165 Ga0500644_0004568 3300053088 Bacteria 3468
166 Ga0500646_0029294 3300053090 Bacteria 1507
167 Ga0500651_0072224 3300053093 Bacteria 2146
168 Ga0500641_0074489 3300053096 Bacteria 1433
169 Ga0500652_025635 3300053131 Bacteria 2262
170 Ga0500579_055304 3300053143 Bacteria 2397
171 Ga0500600_0038061 3300053149 Bacteria 2786
172 Ga0530510_0131942 3300061734 Bacteria 1838

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046531 Ga0495665_0499603 Ga0495665_0499603_17_553 177
2 3300049570 Ga0501033_0000149 Ga0501033_0000149_11352_11903 181
3 3300049823 Ga0501044_0001504 Ga0501044_0001504_4420_4971 181
4 3300009147 Ga0114129_10000114 Ga0114129_1000011479 187
5 3300050507 nmdc:mga05p37_106173_c1 nmdc:mga05p37_106173_c1_895_1509 187
6 3300014968 Ga0157379_10142495 Ga0157379_101424951 189
7 3300031824 Ga0307413_10055634 Ga0307413_100556342 191
8 3300009177 Ga0105248_10113585 Ga0105248_101135853 192
9 3300025941 Ga0207711_10068038 Ga0207711_100680383 192
10 3300026116 Ga0207674_10168891 Ga0207674_101688912 195
11 3300005436 Ga0070713_100162816 Ga0070713_1001628163 197
12 3300035111 Ga0373923_0027016 Ga0373923_0027016_1638_2234 197
13 3300035117 Ga0373953_0032861 Ga0373953_0032861_1389_1985 197
14 3300035118 Ga0373954_0015862 Ga0373954_0015862_783_1379 197
15 3300035120 Ga0373957_0064174 Ga0373957_0064174_550_1146 197
16 3300035170 Ga0373943_0113293 Ga0373943_0113293_128_727 197
17 3300035171 Ga0373946_0027576 Ga0373946_0027576_1186_1785 197
18 3300035172 Ga0373955_0210779 Ga0373955_0210779_186_782 197
19 3300035692 Ga0373935_0249847 Ga0373935_0249847_434_1030 197
20 3300035725 Ga0373947_0152934 Ga0373947_0152934_694_1293 197
21 3300037068 Ga0373925_0571388 Ga0373925_0571388_207_806 197
22 3300045976 Ga0466967_0000204 Ga0466967_0000204_20482_21084 197
23 3300046459 Ga0495629_0251502 Ga0495629_0251502_439_1038 197
24 3300046462 Ga0495651_0004613 Ga0495651_0004613_7763_8359 197
25 3300046463 Ga0495653_0106500 Ga0495653_0106500_1354_1953 197
26 3300046476 Ga0495662_0024768 Ga0495662_0024768_1421_2020 197
27 3300046477 Ga0495664_0070586 Ga0495664_0070586_414_1010 197
28 3300046477 Ga0495664_0228352 Ga0495664_0228352_373_972 197
29 3300046516 Ga0495628_0073226 Ga0495628_0073226_834_1430 197
30 3300046529 Ga0495652_0027559 Ga0495652_0027559_2168_2764 197
31 3300046529 Ga0495652_0133751 Ga0495652_0133751_1261_1860 197
32 3300046533 Ga0495640_0061915 Ga0495640_0061915_1224_1823 197
33 3300046533 Ga0495640_0093352 Ga0495640_0093352_1314_1910 197
34 3300046536 Ga0495587_0018981 Ga0495587_0018981_3587_4183 197
35 3300046543 Ga0495645_0023054 Ga0495645_0023054_2983_3582 197
36 3300046543 Ga0495645_0089953 Ga0495645_0089953_927_1523 197
37 3300046559 Ga0495667_0018570 Ga0495667_0018570_2979_3575 197
38 3300046663 Ga0495635_0067952 Ga0495635_0067952_874_1473 197
39 3300046675 Ga0495657_0014837 Ga0495657_0014837_607_1203 197
40 3300046678 Ga0495599_0377695 Ga0495599_0377695_28_627 197
41 3300046809 Ga0495600_0100572 Ga0495600_0100572_62_658 197
42 3300047319 Ga0495674_0004688 Ga0495674_0004688_11057_11656 197
43 3300047319 Ga0495674_0130771 Ga0495674_0130771_317_913 197
44 3300047322 Ga0495680_0015228 Ga0495680_0015228_4766_5362 197
45 3300047471 Ga0495684_0007758 Ga0495684_0007758_6164_6760 197
46 3300047471 Ga0495684_0151290 Ga0495684_0151290_470_1069 197
47 3300053077 Ga0495601_0242800 Ga0495601_0242800_166_762 197
48 3300053085 Ga0495619_0072627 Ga0495619_0072627_1529_2125 197
49 3300006844 Ga0075428_100000164 Ga0075428_1000001645 198
50 3300006844 Ga0075428_100294337 Ga0075428_1002943372 198
51 3300006847 Ga0075431_100252860 Ga0075431_1002528602 198
52 3300031456 Ga0307513_10000007 Ga0307513_1000000776 198
53 3300035692 Ga0373935_0206373 Ga0373935_0206373_173_829 198
54 3300037068 Ga0373925_0115257 Ga0373925_0115257_619_1260 198
55 3300037068 Ga0373925_0185008 Ga0373925_0185008_133_789 198
56 3300050510 nmdc:mga06r32_126190_c1 nmdc:mga06r32_126190_c1_169_780 198
57 iso_pu_bacteria 8003856774 8003862037 198
58 3300005718 Ga0068866_10082289 Ga0068866_100822893 199
59 3300006846 Ga0075430_100616416 Ga0075430_1006164161 199
60 3300049576 Ga0501040_0361874 Ga0501040_0361874_120_734 199
61 3300050509 nmdc:mga0qj67_658288_c1 nmdc:mga0qj67_658288_c1_182_784 199
62 3300061734 Ga0530510_0131942 Ga0530510_0131942_453_1067 199
63 3300031616 Ga0307508_10064611 Ga0307508_100646112 200
64 3300031616 Ga0307508_10130917 Ga0307508_101309171 200
65 3300003316 rootH1_10129639 rootH1_101296392 201
66 3300005329 Ga0070683_100000178 Ga0070683_10000017812 201
67 3300005338 Ga0068868_101008738 Ga0068868_1010087381 201
68 3300005535 Ga0070684_100005794 Ga0070684_10000579410 201
69 3300025944 Ga0207661_10002728 Ga0207661_100027282 201
70 3300028786 Ga0307517_10077268 Ga0307517_100772682 201
71 3300028794 Ga0307515_10052633 Ga0307515_100526335 201
72 3300030522 Ga0307512_10010661 Ga0307512_100106619 201
73 3300031616 Ga0307508_10028153 Ga0307508_100281533 201
74 3300031616 Ga0307508_10488748 Ga0307508_104887481 201
75 3300031730 Ga0307516_10036773 Ga0307516_100367733 201
76 3300031730 Ga0307516_10046233 Ga0307516_100462332 201
77 3300033179 Ga0307507_10105895 Ga0307507_101058952 201
78 3300053131 Ga0500652_025635 Ga0500652_025635_486_1094 201
79 3300005435 Ga0070714_100204148 Ga0070714_1002041483 202
80 3300005535 Ga0070684_100148625 Ga0070684_1001486252 202
81 3300005616 Ga0068852_100401788 Ga0068852_1004017882 202
82 3300005618 Ga0068864_100005930 Ga0068864_1000059303 202
83 3300005618 Ga0068864_100264181 Ga0068864_1002641812 202
84 3300005842 Ga0068858_100157748 Ga0068858_1001577481 202
85 3300005842 Ga0068858_100606330 Ga0068858_1006063302 202
86 3300009101 Ga0105247_10533244 Ga0105247_105332442 202
87 3300009147 Ga0114129_10712036 Ga0114129_107120362 202
88 3300009177 Ga0105248_10320109 Ga0105248_103201092 202
89 3300014325 Ga0163163_10030261 Ga0163163_100302612 202
90 3300014968 Ga0157379_10237647 Ga0157379_102376472 202
91 3300025928 Ga0207700_10439231 Ga0207700_104392312 202
92 3300025941 Ga0207711_10113612 Ga0207711_101136122 202
93 3300025986 Ga0207658_10667001 Ga0207658_106670012 202
94 3300026035 Ga0207703_10069946 Ga0207703_100699463 202
95 3300026078 Ga0207702_10650292 Ga0207702_106502922 202
96 3300026088 Ga0207641_10624783 Ga0207641_106247831 202
97 3300026095 Ga0207676_10007273 Ga0207676_100072734 202
98 3300028794 Ga0307515_10001812 Ga0307515_1000181225 202
99 3300028794 Ga0307515_10108372 Ga0307515_101083724 202
100 3300031616 Ga0307508_10030740 Ga0307508_100307405 202
101 3300031649 Ga0307514_10374800 Ga0307514_103748001 202
102 3300031730 Ga0307516_10013922 Ga0307516_100139225 202
103 3300031730 Ga0307516_10051103 Ga0307516_100511032 202
104 3300031901 Ga0307406_10467327 Ga0307406_104673272 202
105 3300031995 Ga0307409_100362419 Ga0307409_1003624191 202
106 3300032002 Ga0307416_100858553 Ga0307416_1008585532 202
107 3300034957 Ga0373938_0047749 Ga0373938_0047749_185_799 202
108 3300035088 Ga0373940_0000542 Ga0373940_0000542_4198_4812 202
109 3300035115 Ga0373941_0095163 Ga0373941_0095163_350_964 202
110 3300035207 Ga0373942_0000550 Ga0373942_0000550_2182_2796 202
111 3300041451 Ga0451791_1520341 Ga0451791_1520341_363_977 202
112 3300046459 Ga0495629_0058376 Ga0495629_0058376_360_1007 202
113 3300046519 Ga0495632_0147845 Ga0495632_0147845_186_800 202
114 3300046689 Ga0495613_0349883 Ga0495613_0349883_169_816 202
115 3300047673 Ga0495593_0276583 Ga0495593_0276583_146_793 202
116 3300048904 Ga0496101_0122308 Ga0496101_0122308_152_799 202
117 3300048907 Ga0496104_0016129 Ga0496104_0016129_4516_5163 202
118 3300048908 Ga0496105_0016440 Ga0496105_0016440_1992_2639 202
119 3300048911 Ga0496108_0149300 Ga0496108_0149300_1216_1863 202
120 3300048912 Ga0496109_0071092 Ga0496109_0071092_493_1140 202
121 3300048913 Ga0496110_0137640 Ga0496110_0137640_1459_2106 202
122 3300048914 Ga0496111_0046579 Ga0496111_0046579_655_1302 202
123 3300048915 Ga0496112_0074237 Ga0496112_0074237_2614_3261 202
124 3300048916 Ga0496113_0017490 Ga0496113_0017490_456_1103 202
125 3300048911 Ga0496108_0000043 Ga0496108_0000043_105737_106354 203
126 3300003320 rootH2_10003046 rootH2_100030463 207
127 3300003322 rootL2_10266955 rootL2_102669551 207
128 3300030521 Ga0307511_10166442 Ga0307511_101664421 207
129 3300053143 Ga0500579_055304 Ga0500579_055304_1711_2355 212
130 3300053149 Ga0500600_0038061 Ga0500600_0038061_139_783 212
131 3300006844 Ga0075428_100110272 Ga0075428_1001102721 213
132 iso_pu_bacteria 2751185782 2753265190 214
133 3300032004 Ga0307414_11233876 Ga0307414_112338761 215
134 3300028379 Ga0268266_11001636 Ga0268266_110016362 216
135 3300028794 Ga0307515_10101839 Ga0307515_101018394 216
136 3300030522 Ga0307512_10057739 Ga0307512_100577392 216
137 3300053088 Ga0500644_0004568 Ga0500644_0004568_2683_3348 216
138 3300053090 Ga0500646_0029294 Ga0500646_0029294_100_765 216
139 3300053093 Ga0500651_0072224 Ga0500651_0072224_562_1227 216
140 3300053096 Ga0500641_0074489 Ga0500641_0074489_104_769 216
141 3300031731 Ga0307405_10059562 Ga0307405_100595622 217
142 3300031901 Ga0307406_10437233 Ga0307406_104372331 217
143 3300031995 Ga0307409_100711643 Ga0307409_1007116432 217
144 3300032002 Ga0307416_100111379 Ga0307416_1001113792 217
145 3300003316 rootH1_10054933 rootH1_100549332 218
146 3300003322 rootL2_10079336 rootL2_100793364 218
147 3300005367 Ga0070667_100017797 Ga0070667_1000177972 218
148 3300013296 Ga0157374_11276042 Ga0157374_112760421 218
149 3300026121 Ga0207683_10150570 Ga0207683_101505702 218
150 3300031507 Ga0307509_10031033 Ga0307509_100310332 218
151 3300031911 Ga0307412_10477835 Ga0307412_104778352 218
152 3300003322 rootL2_10103528 rootL2_101035282 219
153 3300005347 Ga0070668_100000729 Ga0070668_1000007292 219
154 3300005985 Ga0081539_10001279 Ga0081539_100012796 219
155 3300025972 Ga0207668_10000539 Ga0207668_100005392 219
156 3300028786 Ga0307517_10221885 Ga0307517_102218852 219
157 3300031901 Ga0307406_10034335 Ga0307406_100343352 219
158 3300035091 Ga0373951_0000028 Ga0373951_0000028_52485_53165 219
159 3300035114 Ga0373939_0069854 Ga0373939_0069854_403_1083 219
160 3300035242 Ga0373962_0005353 Ga0373962_0005353_1196_1876 219
161 3300037853 Ga0436364_0117530 Ga0436364_0117530_397_1086 219
162 3300031731 Ga0307405_10077765 Ga0307405_100777652 220
163 3300031889 Ga0326468_10000956 Ga0326468_100009562 220
164 3300031901 Ga0307406_10004670 Ga0307406_100046702 220
165 3300031903 Ga0307407_10058297 Ga0307407_100582973 220
166 3300031995 Ga0307409_100008694 Ga0307409_1000086942 220
167 3300032002 Ga0307416_100575720 Ga0307416_1005757202 220
168 3300032004 Ga0307414_10467365 Ga0307414_104673652 220
169 3300032005 Ga0307411_10202846 Ga0307411_102028462 220
170 3300042016 Ga0439463_008591 Ga0439463_008591_952_1617 220
171 3300042157 Ga0439458_0037560 Ga0439458_0037560_358_1023 220
172 3300003203 JGI25406J46586_10029511 JGI25406J46586_100295113 224
173 3300005985 Ga0081539_10003532 Ga0081539_1000353211 224
174 3300031649 Ga0307514_10271529 Ga0307514_102715292 224

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13649

Methyltransf_25

Methyltransferase domain

93

185

0.89

PF05175

MTS

Methyltransferase small domain

56

224

0.89

PF08241

Methyltransf_11

Methyltransferase domain

94

189

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dus-assembly1.cif.gz_A mj0882-a hypothetical protein from m. jannaschii 0.869 29 219
5kpg-assembly1.cif.gz_B pavine n-methyltransferase in complex with s-adenosylhomocysteine ph 7 0.8605 86 183
6gkz-assembly2.cif.gz_B-2 crystal structure of coclaurine n-methyltransferase (cnmt) bound to n-methylheliamine and sah 0.8578 86 183
5kpg-assembly1.cif.gz_A pavine n-methyltransferase in complex with s-adenosylhomocysteine ph 7 0.857 86 183
6p3n-assembly1.cif.gz_A-2 tetrahydroprotoberberine n-methyltransferase in complex with s-adenosylmethionine 0.8556 86 183
ID Description Score Start End Superfamily
af_Q2G0N7_5_202_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9043 31 219 3.40.50.150
af_Q2G0N7_5_202_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.861 31 219 3.40.50.150
af_Q8I3G1_737_866_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8589 86 154 3.40.50.150
af_Q54DT3_27_230_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8563 86 222 3.40.50.150
af_Q9VQF8_15_222_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8527 86 219 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7X7S5J1-F1-model_v4 Methyltransferase 0.9861 87 219 GO:0008757
GO:0032259
AF-A0A3D5AHH9-F1-model_v4 MFS transporter 0.9786 65 221 GO:0008757
GO:0032259
AF-A0A535YUS4-F1-model_v4 Methyltransferase 0.9773 147 222 GO:0008168
GO:0032259
AF-A0A7Y2IEQ2-F1-model_v4 Methyltransferase 0.9718 53 222 GO:0008757
GO:0032259
AF-A0A3D4X515-F1-model_v4 MFS transporter 0.9697 92 221 GO:0008757
GO:0032259

Feature Viewer

pLDDT pTM Quality
85.21 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map