F264353

General Info

Members Datasets Scaffolds Average Seq Length
174 107 348 321

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100258408|Ga0075428_1002584082
Length 342
Sequence MPPFDGPAAAAGDGDRAAAGARLVPKVELHVHLEGTAPPDLIRRIAERNGLEVPEGTFAAPDRFAYRDFLDFLDTYDKAASVIRTGEDYRDITYEYLVKCAGEGAIYVELTASPDHAKLVGLTDEEHIDGIARGIDEARRDAGIEGRILISCVRNFGVEPAMRVARYAAERPHPYIVGFSMAGDEENYPPAAYAEAFQIAADAGLGCTVHAGEWAGPESVRGGLELPVSRIAHGVRSIEDPALVEQLAERGTYLECCPTSNVVLGIYPSYEEHPLPTLIAAGVRVTLGSDDPPYFGASIGGEYEICREHFGFADEDLRAITRTAIEAAFCEGALKQRLTESV

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
6 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
7 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
8 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
9 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
10 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
11 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
13 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
14 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
16 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
17 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
18 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
19 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
20 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
22 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
26 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
27 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
28 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
29 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
30 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
31 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
44 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
46 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
47 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
48 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
49 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
50 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
51 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
52 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
53 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
54 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
55 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
56 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
57 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
58 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
59 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
60 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
61 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
62 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
63 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
64 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
65 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
66 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
67 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
68 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
69 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
70 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
71 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
72 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
73 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
74 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
75 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
76 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
77 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
78 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
79 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
80 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
81 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
82 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
83 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
84 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
85 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
86 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
87 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
88 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
89 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
90 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
91 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
92 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
93 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
94 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
97 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
98 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
99 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
100 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
101 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
102 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
103 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
104 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
105 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
106 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
107 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 15.52
Rhizosphere 69.54
Stem 0
Stem Tuber 0
Unclassified 3.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100258408 3300006844 Bacteria 1876
2 rootH1_10102033 3300003323 Bacteria 1385
3 JGI25407J50210_10020899 3300003373 Bacteria 1702
4 JGI25407J50210_10033084 3300003373 Bacteria 1336
5 Ga0070713_100021678 3300005436 Bacteria 4948
6 Ga0070713_100026047 3300005436 Bacteria 4584
7 Ga0070713_100079077 3300005436 Bacteria 2800
8 Ga0070700_100102512 3300005441 Bacteria 1888
9 Ga0070662_100007195 3300005457 Bacteria 7208
10 Ga0070665_100003257 3300005548 Bacteria 17435
11 Ga0068854_100058924 3300005578 Bacteria 2774
12 Ga0070702_100004972 3300005615 Bacteria 6138
13 Ga0068852_100286377 3300005616 Bacteria 1590
14 Ga0081455_10038981 3300005937 Bacteria 4203
15 Ga0081455_10046832 3300005937 Bacteria 3748
16 Ga0081538_10001461 3300005981 Bacteria 24255
17 Ga0081538_10009902 3300005981 Bacteria 7879
18 Ga0081538_10014600 3300005981 Bacteria 6142
19 Ga0081540_1030152 3300005983 Bacteria 3009
20 Ga0081539_10003206 3300005985 Bacteria 20667
21 Ga0081539_10022585 3300005985 Bacteria 4157
22 Ga0070717_10010276 3300006028 Bacteria 7055
23 Ga0070717_10015475 3300006028 Bacteria 5893
24 Ga0070717_10037841 3300006028 Bacteria 3919
25 Ga0070716_100067814 3300006173 Bacteria 2085
26 Ga0070712_100034679 3300006175 Bacteria 3421
27 Ga0075428_100019527 3300006844 Bacteria 7499
28 Ga0075430_100010241 3300006846 Bacteria 7938
29 Ga0075431_100544996 3300006847 Unclassified 1148
30 Ga0111539_10024291 3300009094 Bacteria 7442
31 Ga0105245_10040166 3300009098 Bacteria 4167
32 Ga0114129_10003704 3300009147 Bacteria 21527
33 Ga0114129_10192207 3300009147 Bacteria 2771
34 Ga0114129_10719937 3300009147 Bacteria 1281
35 Ga0105249_10008854 3300009553 Bacteria 8790
36 Ga0105239_10018139 3300010375 Bacteria 7780
37 Ga0157378_10061303 3300013297 Bacteria 3356
38 Ga0157372_10679921 3300013307 Bacteria 1198
39 Ga0163163_10073214 3300014325 Bacteria 3416
40 Ga0213874_10002120 3300021377 Bacteria 4209
41 Ga0213874_10051624 3300021377 Bacteria 1263
42 Ga0213876_10036047 3300021384 Bacteria 2609
43 Ga0213876_10037861 3300021384 Bacteria 2544
44 Ga0213875_10000558 3300021388 Bacteria 30352
45 Ga0213875_10060925 3300021388 Bacteria 1764
46 Ga0207692_10041119 3300025898 Bacteria 2286
47 Ga0207692_10254085 3300025898 Unclassified 1054
48 Ga0207693_10003964 3300025915 Bacteria 12580
49 Ga0207687_10288706 3300025927 Bacteria 1318
50 Ga0207700_10016905 3300025928 Bacteria 4858
51 Ga0207700_10078170 3300025928 Bacteria 2573
52 Ga0207700_10092073 3300025928 Bacteria 2396
53 Ga0207664_10001921 3300025929 Bacteria 13642
54 Ga0207664_10051034 3300025929 Bacteria 3264
55 Ga0207706_10007660 3300025933 Bacteria 9975
56 Ga0207706_10402321 3300025933 Bacteria 1187
57 Ga0207704_10134595 3300025938 Bacteria 1718
58 Ga0207665_10217221 3300025939 Bacteria 1399
59 Ga0207640_10088169 3300025981 Bacteria 2141
60 Ga0207640_10238893 3300025981 Bacteria 1403
61 Ga0207708_10012706 3300026075 Bacteria 6278
62 Ga0207675_100002860 3300026118 Bacteria 16985
63 Ga0207698_10204982 3300026142 Bacteria 1769
64 Ga0207428_10027927 3300027907 Bacteria 4693
65 Ga0268266_10011179 3300028379 Bacteria 7813
66 Ga0307406_10075344 3300031901 Bacteria 2226
67 Ga0307415_100009906 3300032126 Bacteria 5372
68 Ga0373943_0028079 3300035170 Bacteria 2650
69 Ga0373927_0184995 3300035695 Bacteria 1367
70 Ga0373937_0043354 3300036401 Bacteria 4106
71 Ga0373925_0264097 3300037068 Bacteria 1383
72 Ga0395898_0153187 3300037466 Bacteria 2205
73 Ga0395898_0428608 3300037466 Unclassified 1260
74 Ga0395898_0548693 3300037466 Bacteria 1098
75 Ga0395905_0175842 3300037471 Bacteria 2010
76 Ga0436364_0466655 3300037853 Bacteria 48058
77 Ga0436364_0508709 3300037853 Bacteria 1636
78 Ga0436364_0618526 3300037853 Bacteria 5521
79 Ga0436364_0635502 3300037853 Bacteria 1904
80 Ga0436364_0672197 3300037853 Bacteria 918
81 Ga0436364_1052871 3300037853 Bacteria 5276
82 Ga0436364_1143529 3300037853 Bacteria 2357
83 Ga0436364_1260201 3300037853 Bacteria 29416
84 Ga0395901_0013639 3300038443 Bacteria 8263
85 Ga0436365_0324511 3300039437 Bacteria 15575
86 Ga0436365_0611440 3300039437 Bacteria 7756
87 Ga0436365_0615015 3300039437 Bacteria 1491
88 Ga0436365_0711729 3300039437 Bacteria 1816
89 Ga0436365_1927827 3300039437 Bacteria 2345
90 Ga0436363_0031598 3300039450 Bacteria 1940
91 Ga0436363_0372259 3300039450 Bacteria 15776
92 Ga0436363_0589647 3300039450 Bacteria 4266
93 Ga0436363_0774583 3300039450 Bacteria 1789
94 Ga0436363_0934027 3300039450 Bacteria 8186
95 Ga0436362_0537216 3300039453 Bacteria 6180
96 Ga0436362_0829853 3300039453 Unclassified 1526
97 Ga0451853_1672324 3300041512 Bacteria 1672
98 Ga0466961_0050174 3300044693 Bacteria 2665
99 Ga0466963_0078200 3300044694 Bacteria 2236
100 Ga0466971_0027132 3300044719 Bacteria 2564
101 Ga0466971_0094249 3300044719 Bacteria 1372
102 Ga0466970_0118065 3300044765 Bacteria 1452
103 Ga0466959_0007783 3300045049 Bacteria 7538
104 Ga0466959_0050929 3300045049 Bacteria 3039
105 Ga0466959_0059982 3300045049 Bacteria 2769
106 Ga0466958_0010448 3300045836 Bacteria 5201
107 Ga0466958_0037387 3300045836 Bacteria 2909
108 Ga0466967_0047759 3300045976 Bacteria 3734
109 Ga0495629_0064487 3300046459 Bacteria 2558
110 Ga0495641_0014489 3300046461 Bacteria 4261
111 Ga0495641_0070807 3300046461 Bacteria 1566
112 Ga0495651_0081390 3300046462 Bacteria 2444
113 Ga0495653_0093018 3300046463 Bacteria 2200
114 Ga0495608_0073721 3300046511 Bacteria 2225
115 Ga0495620_0048609 3300046515 Bacteria 1820
116 Ga0495628_0035543 3300046516 Bacteria 4003
117 Ga0495628_0211251 3300046516 Bacteria 1460
118 Ga0495644_0066186 3300046523 Bacteria 1357
119 Ga0495640_0082020 3300046533 Bacteria 2143
120 Ga0495667_0184621 3300046559 Bacteria 1337
121 Ga0495656_0025313 3300046615 Bacteria 2352
122 Ga0495599_0051995 3300046678 Bacteria 2567
123 Ga0495646_0055782 3300046680 Bacteria 2371
124 Ga0495604_0039071 3300047317 Bacteria 3731
125 Ga0495674_0059507 3300047319 Bacteria 3336
126 Ga0495674_0190427 3300047319 Bacteria 1705
127 Ga0495676_0179617 3300047321 Bacteria 1484
128 Ga0496100_0003395 3300048903 Bacteria 8299
129 Ga0496104_0008455 3300048907 Bacteria 9151
130 Ga0496104_0031046 3300048907 Bacteria 4967
131 Ga0496104_0055267 3300048907 Bacteria 3754
132 Ga0496104_0074394 3300048907 Bacteria 3234
133 Ga0496105_0021919 3300048908 Bacteria 5170
134 Ga0496105_0217945 3300048908 Bacteria 1554
135 Ga0496106_0056932 3300048909 Bacteria 2956
136 Ga0496108_0001374 3300048911 Bacteria 19147
137 Ga0496108_0119155 3300048911 Bacteria 2263
138 Ga0496109_0001576 3300048912 Bacteria 19033
139 Ga0496109_0146300 3300048912 Bacteria 2211
140 Ga0496109_0563980 3300048912 Unclassified 1074
141 Ga0496110_0028419 3300048913 Bacteria 4803
142 Ga0496110_0066877 3300048913 Bacteria 3178
143 Ga0496111_0014010 3300048914 Bacteria 5467
144 Ga0496111_0023846 3300048914 Bacteria 4299
145 Ga0496112_0014890 3300048915 Bacteria 7237
146 Ga0496112_0081515 3300048915 Bacteria 3200
147 Ga0496112_0090584 3300048915 Bacteria 3027
148 Ga0496112_0187410 3300048915 Bacteria 2032
149 Ga0496113_0020607 3300048916 Bacteria 4639
150 Ga0496113_0032003 3300048916 Bacteria 3821
151 Ga0496113_0195723 3300048916 Bacteria 1605
152 Ga0496113_0204804 3300048916 Bacteria 1569
153 Ga0496114_0107214 3300048917 Bacteria 2391
154 Ga0496115_0005387 3300048918 Bacteria 9306
155 Ga0501031_0105101 3300049568 Bacteria 1843
156 Ga0501046_0259972 3300049580 Bacteria 1276
157 Ga0501075_0217492 3300049591 Bacteria 1457
158 Ga0501079_0237545 3300049741 Bacteria 1424
159 Ga0501045_0178956 3300049824 Bacteria 1580
160 nmdc:mga05p37_109201_c1 3300050507 Bacteria 3403
161 nmdc:mga05p37_473039_c1 3300050507 Unclassified 1445
162 nmdc:mga05p37_5885_c1 3300050507 Bacteria 14422
163 nmdc:mga09592_19669_c1 3300050508 Bacteria 5545
164 nmdc:mga09592_286065_c1 3300050508 Bacteria 1429
165 nmdc:mga09592_38153_c1 3300050508 Bacteria 4031
166 nmdc:mga0qj67_5101_c1 3300050509 Bacteria 9557
167 nmdc:mga0qj67_92722_c1 3300050509 Bacteria 2428
168 nmdc:mga06r32_112572_c1 3300050510 Bacteria 2678
169 nmdc:mga08y16_61186_c1 3300050511 Bacteria 3932
170 nmdc:mga0a205_41449_c1 3300050515 Bacteria 4433
171 Ga0495595_0016834 3300053084 Bacteria 3135
172 Ga0501082_0170726 3300060353 Bacteria 1891
173 Ga0466962_0014634 3300061719 Bacteria 3781
174 Ga0466962_0027186 3300061719 Bacteria 2747
175 Ga0075428_100258408
176 rootH1_10102033
177 JGI25407J50210_10020899
178 JGI25407J50210_10033084
179 Ga0070713_100021678
180 Ga0070713_100026047
181 Ga0070713_100079077
182 Ga0070700_100102512
183 Ga0070662_100007195
184 Ga0070665_100003257
185 Ga0068854_100058924
186 Ga0070702_100004972
187 Ga0068852_100286377
188 Ga0081455_10038981
189 Ga0081455_10046832
190 Ga0081538_10001461
191 Ga0081538_10009902
192 Ga0081538_10014600
193 Ga0081540_1030152
194 Ga0081539_10003206
195 Ga0081539_10022585
196 Ga0070717_10010276
197 Ga0070717_10015475
198 Ga0070717_10037841
199 Ga0070716_100067814
200 Ga0070712_100034679
201 Ga0075428_100019527
202 Ga0075430_100010241
203 Ga0075431_100544996
204 Ga0111539_10024291
205 Ga0105245_10040166
206 Ga0114129_10003704
207 Ga0114129_10192207
208 Ga0114129_10719937
209 Ga0105249_10008854
210 Ga0105239_10018139
211 Ga0157378_10061303
212 Ga0157372_10679921
213 Ga0163163_10073214
214 Ga0213874_10002120
215 Ga0213874_10051624
216 Ga0213876_10036047
217 Ga0213876_10037861
218 Ga0213875_10000558
219 Ga0213875_10060925
220 Ga0207692_10041119
221 Ga0207692_10254085
222 Ga0207693_10003964
223 Ga0207687_10288706
224 Ga0207700_10016905
225 Ga0207700_10078170
226 Ga0207700_10092073
227 Ga0207664_10001921
228 Ga0207664_10051034
229 Ga0207706_10007660
230 Ga0207706_10402321
231 Ga0207704_10134595
232 Ga0207665_10217221
233 Ga0207640_10088169
234 Ga0207640_10238893
235 Ga0207708_10012706
236 Ga0207675_100002860
237 Ga0207698_10204982
238 Ga0207428_10027927
239 Ga0268266_10011179
240 Ga0307406_10075344
241 Ga0307415_100009906
242 Ga0373943_0028079
243 Ga0373927_0184995
244 Ga0373937_0043354
245 Ga0373925_0264097
246 Ga0395898_0153187
247 Ga0395898_0428608
248 Ga0395898_0548693
249 Ga0395905_0175842
250 Ga0436364_0466655
251 Ga0436364_0508709
252 Ga0436364_0618526
253 Ga0436364_0635502
254 Ga0436364_0672197
255 Ga0436364_1052871
256 Ga0436364_1143529
257 Ga0436364_1260201
258 Ga0395901_0013639
259 Ga0436365_0324511
260 Ga0436365_0611440
261 Ga0436365_0615015
262 Ga0436365_0711729
263 Ga0436365_1927827
264 Ga0436363_0031598
265 Ga0436363_0372259
266 Ga0436363_0589647
267 Ga0436363_0774583
268 Ga0436363_0934027
269 Ga0436362_0537216
270 Ga0436362_0829853
271 Ga0451853_1672324
272 Ga0466961_0050174
273 Ga0466963_0078200
274 Ga0466971_0027132
275 Ga0466971_0094249
276 Ga0466970_0118065
277 Ga0466959_0007783
278 Ga0466959_0050929
279 Ga0466959_0059982
280 Ga0466958_0010448
281 Ga0466958_0037387
282 Ga0466967_0047759
283 Ga0495629_0064487
284 Ga0495641_0014489
285 Ga0495641_0070807
286 Ga0495651_0081390
287 Ga0495653_0093018
288 Ga0495608_0073721
289 Ga0495620_0048609
290 Ga0495628_0035543
291 Ga0495628_0211251
292 Ga0495644_0066186
293 Ga0495640_0082020
294 Ga0495667_0184621
295 Ga0495656_0025313
296 Ga0495599_0051995
297 Ga0495646_0055782
298 Ga0495604_0039071
299 Ga0495674_0059507
300 Ga0495674_0190427
301 Ga0495676_0179617
302 Ga0496100_0003395
303 Ga0496104_0008455
304 Ga0496104_0031046
305 Ga0496104_0055267
306 Ga0496104_0074394
307 Ga0496105_0021919
308 Ga0496105_0217945
309 Ga0496106_0056932
310 Ga0496108_0001374
311 Ga0496108_0119155
312 Ga0496109_0001576
313 Ga0496109_0146300
314 Ga0496109_0563980
315 Ga0496110_0028419
316 Ga0496110_0066877
317 Ga0496111_0014010
318 Ga0496111_0023846
319 Ga0496112_0014890
320 Ga0496112_0081515
321 Ga0496112_0090584
322 Ga0496112_0187410
323 Ga0496113_0020607
324 Ga0496113_0032003
325 Ga0496113_0195723
326 Ga0496113_0204804
327 Ga0496114_0107214
328 Ga0496115_0005387
329 Ga0501031_0105101
330 Ga0501046_0259972
331 Ga0501075_0217492
332 Ga0501079_0237545
333 Ga0501045_0178956
334 nmdc:mga05p37_109201_c1
335 nmdc:mga05p37_473039_c1
336 nmdc:mga05p37_5885_c1
337 nmdc:mga09592_19669_c1
338 nmdc:mga09592_286065_c1
339 nmdc:mga09592_38153_c1
340 nmdc:mga0qj67_5101_c1
341 nmdc:mga0qj67_92722_c1
342 nmdc:mga06r32_112572_c1
343 nmdc:mga08y16_61186_c1
344 nmdc:mga0a205_41449_c1
345 Ga0495595_0016834
346 Ga0501082_0170726
347 Ga0466962_0014634
348 Ga0466962_0027186

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00962

A_deaminase

Adenosine deaminase

25

342

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pbm-assembly1.cif.gz_A the crystal structure of adenosine deaminase in complex with chloropurine from pseudomonas aeruginosa 0.9152 1 304
3rys-assembly2.cif.gz_B the crystal structure of adenine deaminase (aaur1117) from arthrobacter aurescens 0.915 1 320
3t1g-assembly1.cif.gz_A engineering of organophosphate hydrolase by computational design and directed evolution 0.9083 2 320
3mvt-assembly1.cif.gz_A crystal structure of apo mada at 2.2a resolution 0.907 2 320
3rys-assembly2.cif.gz_B the crystal structure of adenine deaminase (aaur1117) from arthrobacter aurescens 0.9068 1 320
ID Description Score Start End Superfamily
af_Q9P6I7_4_353_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9373 2 320 3.20.20.140
af_Q54KF3_1_358_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9304 2 319 3.20.20.140
af_Q9P6I7_4_353_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9261 2 320 3.20.20.140
af_P53909_2_346_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9227 2 320 3.20.20.140
af_Q54KF3_1_358_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9165 2 319 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A528JJT7-F1-model_v4 Adenosine deaminase 0.9873 172 320 GO:0019239
AF-A0A351CLM1-F1-model_v4 Adenosine deaminase 0.9801 112 318 GO:0009168
GO:0016814
GO:0019239
AF-A0A3S1RTK7-F1-model_v4 Adenosine deaminase 0.9787 185 321 GO:0019239
AF-A0A838EQN1-F1-model_v4 Adenosine deaminase domain-containing protein 0.9776 212 320 GO:0009168
GO:0016814
GO:0019239
AF-A0A1E5JW87-F1-model_v4 Adenine deaminase 0.9772 3 239 GO:0000034
GO:0005829
GO:0006146
GO:0043103

Map