F264336

General Info

Members Datasets Scaffolds Average Seq Length
174 148 172 127

Family's Representative Sequence

Representative Sequence 3300006237|Ga0097621_100571370|Ga0097621_1005713702
Length 136
Sequence VGKRRRVSQVRLLLDTHTFLYAINFWERLGSNARGALTDTQNERWVSAITLAEIGIKVAIGKLPLPKHPDYYLRHLEALRAEILPVGVQHSLKLLDLPMHHRDPFDRLLIAQAKTEELTIVTQDRAFAAYGVATLW

Samples

Sample ID Description Type Environment
1 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
55 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
75 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
76 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
77 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
78 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
79 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
83 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
84 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
85 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
87 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
92 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
93 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
94 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
95 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
96 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
97 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
98 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
99 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
100 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
101 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
102 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
103 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
104 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
105 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
106 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
107 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
108 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
109 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
110 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
111 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
112 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
113 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
114 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
115 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
116 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
117 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
128 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
129 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
130 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
131 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
132 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
133 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
134 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
135 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
136 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
139 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
143 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
144 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
145 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
146 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
147 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
148 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.28
Metatranscriptomes 0.57
Isolates 1.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.72
Nodule 0
Rhizoplane 4.02
Rhizosphere 89.66
Stem 0
Stem Tuber 0
Unclassified 4.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10226482 3300003322 Unclassified 2104
2 Ga0070683_100016955 3300005329 Bacteria 6428
3 Ga0070682_100309674 3300005337 Bacteria 1162
4 Ga0068868_100345705 3300005338 Bacteria 1273
5 Ga0068868_100601149 3300005338 Unclassified 974
6 Ga0070687_100306663 3300005343 Bacteria 1009
7 Ga0070668_100347329 3300005347 Bacteria 1255
8 Ga0070671_100637692 3300005355 Unclassified 922
9 Ga0070674_101447243 3300005356 Bacteria 616
10 Ga0070709_10000236 3300005434 Bacteria 35739
11 Ga0070714_101810837 3300005435 Unclassified 596
12 Ga0070713_100905077 3300005436 Unclassified 849
13 Ga0070701_10213837 3300005438 Bacteria 1146
14 Ga0070705_101785110 3300005440 Bacteria 521
15 Ga0070700_100025306 3300005441 Bacteria 3495
16 Ga0070694_100929369 3300005444 Unclassified 719
17 Ga0070681_10390168 3300005458 Bacteria 1303
18 Ga0068867_100148057 3300005459 Bacteria 1842
19 Ga0070707_100794064 3300005468 Unclassified 910
20 Ga0070679_101033024 3300005530 Unclassified 766
21 Ga0070672_102137971 3300005543 Bacteria 504
22 Ga0070696_101571836 3300005546 Bacteria 564
23 Ga0070665_100208871 3300005548 Bacteria 1953
24 Ga0070665_100213492 3300005548 Unclassified 1930
25 Ga0068854_101274046 3300005578 Bacteria 661
26 Ga0068856_100028444 3300005614 Bacteria 5459
27 Ga0070702_100063254 3300005615 Bacteria 2160
28 Ga0068859_100214017 3300005617 Bacteria 2014
29 Ga0068866_10286490 3300005718 Bacteria 1023
30 Ga0068861_100556507 3300005719 Bacteria 1046
31 Ga0068870_10125074 3300005840 Bacteria 1486
32 Ga0068863_100138217 3300005841 Bacteria 2328
33 Ga0068863_100528652 3300005841 Bacteria 1163
34 Ga0081538_10022502 3300005981 Bacteria 4565
35 Ga0081538_10156382 3300005981 Bacteria 1022
36 Ga0081539_10072756 3300005985 Bacteria 1836
37 Ga0081539_10397973 3300005985 Bacteria 573
38 Ga0097621_100571370 3300006237 Unclassified 1031
39 Ga0068871_100238253 3300006358 Bacteria 1581
40 Ga0075428_100121780 3300006844 Bacteria 2840
41 Ga0075428_102366202 3300006844 Unclassified 546
42 Ga0075436_100359021 3300006914 Bacteria 1051
43 Ga0097620_100214019 3300006931 Bacteria 2014
44 Ga0105240_11003597 3300009093 Bacteria 892
45 Ga0105245_10165669 3300009098 Bacteria 2101
46 Ga0105247_10876897 3300009101 Bacteria 691
47 Ga0114129_10206617 3300009147 Bacteria 2657
48 Ga0105241_10129843 3300009174 Bacteria 2039
49 Ga0105241_11750121 3300009174 Bacteria 605
50 Ga0105248_10003504 3300009177 Bacteria 17414
51 Ga0105248_10793195 3300009177 Bacteria 1069
52 Ga0105237_10181947 3300009545 Bacteria 2102
53 Ga0105237_12659354 3300009545 Unclassified 511
54 Ga0105246_10325850 3300011119 Bacteria 1250
55 Ga0157373_10156718 3300013100 Bacteria 1602
56 Ga0157370_10375260 3300013104 Unclassified 1310
57 Ga0157369_10061131 3300013105 Bacteria 4062
58 Ga0157374_10100539 3300013296 Bacteria 2772
59 Ga0157374_10294244 3300013296 Unclassified 1605
60 Ga0163162_10922088 3300013306 Unclassified 986
61 Ga0157372_10945741 3300013307 Unclassified 999
62 Ga0163163_10044348 3300014325 Bacteria 4362
63 Ga0163163_10616978 3300014325 Bacteria 1148
64 Ga0213873_10011030 3300021358 Bacteria 1922
65 Ga0207688_10201898 3300025901 Bacteria 1192
66 Ga0207699_10000125 3300025906 Bacteria 54760
67 Ga0207643_10419477 3300025908 Unclassified 848
68 Ga0207654_10231518 3300025911 Bacteria 1231
69 Ga0207662_10205122 3300025918 Unclassified 1277
70 Ga0207659_11599228 3300025926 Bacteria 556
71 Ga0207687_10072948 3300025927 Bacteria 2457
72 Ga0207664_11165208 3300025929 Unclassified 688
73 Ga0207664_11541236 3300025929 Unclassified 586
74 Ga0207711_10221476 3300025941 Bacteria 1731
75 Ga0207689_10056813 3300025942 Bacteria 3221
76 Ga0207679_10382865 3300025945 Unclassified 1234
77 Ga0207668_10289633 3300025972 Bacteria 1347
78 Ga0207640_10090584 3300025981 Bacteria 2117
79 Ga0207640_10810139 3300025981 Unclassified 812
80 Ga0207677_10352108 3300026023 Bacteria 1234
81 Ga0207708_10342488 3300026075 Bacteria 1225
82 Ga0207648_10126376 3300026089 Bacteria 2249
83 Ga0207674_10739652 3300026116 Bacteria 949
84 Ga0207675_100094303 3300026118 Bacteria 2815
85 Ga0268266_10006545 3300028379 Bacteria 10659
86 Ga0268266_11454270 3300028379 Bacteria 661
87 Ga0265339_10418178 3300031249 Unclassified 625
88 Ga0265313_10246953 3300031595 Bacteria 729
89 Ga0265314_10007539 3300031711 Bacteria 9429
90 Ga0265342_10392871 3300031712 Unclassified 717
91 Ga0316576_10063077 3300031727 Bacteria 2719
92 Ga0316576_10069939 3300031727 Unclassified 2588
93 Ga0316576_10578874 3300031727 Bacteria 821
94 Ga0316578_10082132 3300031728 Bacteria 1918
95 Ga0307410_10093194 3300031852 Unclassified 2143
96 Ga0307406_10544191 3300031901 Bacteria 949
97 Ga0307411_10545000 3300032005 Bacteria 989
98 Ga0316574_0155201 3300035398 Bacteria 1475
99 Ga0373931_0779761 3300035691 Bacteria 636
100 Ga0265778_007330 3300036457 Bacteria 1206
101 Ga0316582_0541667 3300036647 Bacteria 802
102 Ga0316584_0449428 3300036712 Unclassified 912
103 Ga0395899_0038680 3300037312 Bacteria 3572
104 Ga0395900_0026906 3300037418 Bacteria 5887
105 Ga0395901_0001004 3300038443 Bacteria 30516
106 Ga0436360_0424812 3300039438 Bacteria 596
107 Ga0436360_0516032 3300039438 Bacteria 1223
108 Ga0436360_0705347 3300039438 Bacteria 1411
109 Ga0436361_0115901 3300039447 Bacteria 1871
110 Ga0436361_0833684 3300039447 Bacteria 4591
111 Ga0436363_1468001 3300039450 Unclassified 730
112 Ga0436363_1702221 3300039450 Bacteria 4618
113 Ga0436362_0634676 3300039453 Unclassified 1270
114 Ga0451841_1204271 3300041498 Bacteria 816
115 Ga0451847_0609633 3300041503 Bacteria 1624
116 Ga0451577_1118700 3300042876 Unclassified 704
117 Ga0453683_0374213 3300044673 Bacteria 916
118 Ga0466963_0004426 3300044694 Bacteria 8164
119 Ga0453684_0974576 3300044712 Unclassified 903
120 Ga0466957_0026705 3300044842 Bacteria 3427
121 Ga0466959_0360278 3300045049 Unclassified 991
122 Ga0451576_0006007 3300045051 Bacteria 15010
123 Ga0466967_0503525 3300045976 Bacteria 1189
124 Ga0495580_0219505 3300046472 Bacteria 1307
125 Ga0495668_0000292 3300046616 Bacteria 68757
126 Ga0495600_0030927 3300046809 Bacteria 3467
127 Ga0496100_0583410 3300048903 Unclassified 867
128 Ga0496104_0000028 3300048907 Bacteria 203377
129 Ga0496108_0550872 3300048911 Bacteria 1006
130 Ga0496110_0000604 3300048913 Bacteria 24724
131 Ga0496111_0000531 3300048914 Bacteria 19737
132 Ga0496112_1035972 3300048915 Bacteria 740
133 Ga0496113_1433623 3300048916 Bacteria 534
134 Ga0496121_0009523 3300048924 Bacteria 11137
135 Ga0501298_079717 3300049521 Bacteria 719
136 Ga0501031_0251048 3300049568 Bacteria 1150
137 Ga0501031_0409325 3300049568 Bacteria 877
138 Ga0501033_0189148 3300049570 Bacteria 1474
139 Ga0501036_0714865 3300049572 Bacteria 827
140 Ga0501038_0705386 3300049574 Unclassified 756
141 Ga0501039_0137006 3300049575 Bacteria 1922
142 Ga0501040_0208896 3300049576 Bacteria 1388
143 Ga0501040_0618049 3300049576 Bacteria 783
144 Ga0501041_0127490 3300049577 Unclassified 1585
145 Ga0501041_0336406 3300049577 Bacteria 953
146 Ga0501042_0304431 3300049578 Bacteria 1151
147 Ga0501043_0533287 3300049579 Bacteria 874
148 Ga0501048_0104495 3300049582 Bacteria 1999
149 Ga0501071_1294370 3300049587 Bacteria 563
150 Ga0501072_0718759 3300049588 Unclassified 784
151 Ga0501074_0304627 3300049590 Bacteria 1132
152 Ga0501075_1090611 3300049591 Bacteria 606
153 Ga0501076_0224783 3300049592 Bacteria 1534
154 Ga0501077_0124113 3300049593 Unclassified 1637
155 Ga0501077_0794165 3300049593 Bacteria 609
156 Ga0501211_042580 3300049658 Bacteria 545
157 Ga0501243_035284 3300049675 Bacteria 865
158 Ga0501257_070022 3300049686 Unclassified 895
159 Ga0501079_0227485 3300049741 Bacteria 1457
160 Ga0501079_0635904 3300049741 Bacteria 840
161 Ga0501080_0285058 3300049742 Bacteria 1501
162 Ga0501081_0194755 3300049743 Bacteria 1468
163 Ga0501283_015371 3300049779 Bacteria 1178
164 Ga0501035_0925456 3300049822 Unclassified 689
165 Ga0501044_0146763 3300049823 Bacteria 2344
166 nmdc:mga08x19_796216_c1 3300050514 Bacteria 671
167 Ga0500573_0101916 3300053140 Bacteria 1615
168 Ga0500573_0520071 3300053140 Bacteria 533
169 Ga0500609_026875 3300053731 Bacteria 789
170 Ga0501084_0316849 3300054114 Bacteria 1317
171 Ga0501082_0467469 3300060353 Bacteria 1102
172 Ga0530510_0069644 3300061734 Unclassified 2553

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053731 Ga0500609_026875 Ga0500609_026875_42_374 109
2 3300042876 Ga0451577_1118700 Ga0451577_1118700_253_612 119
3 3300044673 Ga0453683_0374213 Ga0453683_0374213_99_458 119
4 3300044712 Ga0453684_0974576 Ga0453684_0974576_352_711 119
5 3300045051 Ga0451576_0006007 Ga0451576_0006007_2399_2758 119
6 3300053140 Ga0500573_0101916 Ga0500573_0101916_15_386 122
7 3300053140 Ga0500573_0520071 Ga0500573_0520071_42_413 122
8 3300046809 Ga0495600_0030927 Ga0495600_0030927_455_826 123
9 iso_pu_bacteria 2617270889 2617919169 123
10 iso_pu_bacteria 642555144 642604996 123
11 3300005337 Ga0070682_100309674 Ga0070682_1003096742 125
12 3300005338 Ga0068868_100345705 Ga0068868_1003457052 125
13 3300005343 Ga0070687_100306663 Ga0070687_1003066633 125
14 3300005347 Ga0070668_100347329 Ga0070668_1003473292 125
15 3300005356 Ga0070674_101447243 Ga0070674_1014472432 125
16 3300005438 Ga0070701_10213837 Ga0070701_102138372 125
17 3300005440 Ga0070705_101785110 Ga0070705_1017851101 125
18 3300005441 Ga0070700_100025306 Ga0070700_1000253065 125
19 3300005444 Ga0070694_100929369 Ga0070694_1009293692 125
20 3300005459 Ga0068867_100148057 Ga0068867_1001480573 125
21 3300005615 Ga0070702_100063254 Ga0070702_1000632542 125
22 3300005617 Ga0068859_100214017 Ga0068859_1002140172 125
23 3300005718 Ga0068866_10286490 Ga0068866_102864902 125
24 3300005719 Ga0068861_100556507 Ga0068861_1005565072 125
25 3300005841 Ga0068863_100528652 Ga0068863_1005286522 125
26 3300006931 Ga0097620_100214019 Ga0097620_1002140192 125
27 3300009174 Ga0105241_11750121 Ga0105241_117501212 125
28 3300009177 Ga0105248_10003504 Ga0105248_100035043 125
29 3300025941 Ga0207711_10221476 Ga0207711_102214764 125
30 3300025972 Ga0207668_10289633 Ga0207668_102896332 125
31 3300025981 Ga0207640_10090584 Ga0207640_100905844 125
32 3300026023 Ga0207677_10352108 Ga0207677_103521082 125
33 3300026075 Ga0207708_10342488 Ga0207708_103424883 125
34 3300026089 Ga0207648_10126376 Ga0207648_101263764 125
35 3300026118 Ga0207675_100094303 Ga0207675_1000943032 125
36 3300037312 Ga0395899_0038680 Ga0395899_0038680_925_1302 125
37 3300037418 Ga0395900_0026906 Ga0395900_0026906_1655_2032 125
38 3300038443 Ga0395901_0001004 Ga0395901_0001004_9438_9815 125
39 3300039447 Ga0436361_0833684 Ga0436361_0833684_1042_1425 125
40 3300045049 Ga0466959_0360278 Ga0466959_0360278_376_768 125
41 3300048911 Ga0496108_0550872 Ga0496108_0550872_568_945 125
42 3300048916 Ga0496113_1433623 Ga0496113_1433623_79_456 125
43 3300049568 Ga0501031_0409325 Ga0501031_0409325_41_418 125
44 3300049576 Ga0501040_0618049 Ga0501040_0618049_231_608 125
45 3300049587 Ga0501071_1294370 Ga0501071_1294370_104_481 125
46 3300005434 Ga0070709_10000236 Ga0070709_100002367 126
47 3300005578 Ga0068854_101274046 Ga0068854_1012740462 126
48 3300005840 Ga0068870_10125074 Ga0068870_101250742 126
49 3300005985 Ga0081539_10072756 Ga0081539_100727563 126
50 3300005985 Ga0081539_10397973 Ga0081539_103979732 126
51 3300009098 Ga0105245_10165669 Ga0105245_101656692 126
52 3300011119 Ga0105246_10325850 Ga0105246_103258503 126
53 3300025901 Ga0207688_10201898 Ga0207688_102018982 126
54 3300025906 Ga0207699_10000125 Ga0207699_100001256 126
55 3300025908 Ga0207643_10419477 Ga0207643_104194772 126
56 3300025918 Ga0207662_10205122 Ga0207662_102051223 126
57 3300025927 Ga0207687_10072948 Ga0207687_100729483 126
58 3300025942 Ga0207689_10056813 Ga0207689_100568134 126
59 3300031711 Ga0265314_10007539 Ga0265314_100075392 126
60 3300035398 Ga0316574_0155201 Ga0316574_0155201_444_851 126
61 3300035691 Ga0373931_0779761 Ga0373931_0779761_86_466 126
62 3300039438 Ga0436360_0424812 Ga0436360_0424812_193_573 126
63 3300039453 Ga0436362_0634676 Ga0436362_0634676_696_1076 126
64 3300045976 Ga0466967_0503525 Ga0466967_0503525_21_407 126
65 3300048903 Ga0496100_0583410 Ga0496100_0583410_195_575 126
66 3300048907 Ga0496104_0000028 Ga0496104_0000028_21587_21991 126
67 3300048913 Ga0496110_0000604 Ga0496110_0000604_15280_15684 126
68 3300048914 Ga0496111_0000531 Ga0496111_0000531_10528_10932 126
69 3300048924 Ga0496121_0009523 Ga0496121_0009523_9992_10372 126
70 3300049568 Ga0501031_0251048 Ga0501031_0251048_488_868 126
71 3300049570 Ga0501033_0189148 Ga0501033_0189148_25_405 126
72 3300049574 Ga0501038_0705386 Ga0501038_0705386_117_497 126
73 3300049575 Ga0501039_0137006 Ga0501039_0137006_1310_1690 126
74 3300049576 Ga0501040_0208896 Ga0501040_0208896_764_1144 126
75 3300049577 Ga0501041_0127490 Ga0501041_0127490_151_531 126
76 3300049578 Ga0501042_0304431 Ga0501042_0304431_338_718 126
77 3300049582 Ga0501048_0104495 Ga0501048_0104495_1513_1893 126
78 3300049588 Ga0501072_0718759 Ga0501072_0718759_269_649 126
79 3300049592 Ga0501076_0224783 Ga0501076_0224783_39_419 126
80 3300049593 Ga0501077_0124113 Ga0501077_0124113_990_1370 126
81 3300049742 Ga0501080_0285058 Ga0501080_0285058_240_620 126
82 3300049743 Ga0501081_0194755 Ga0501081_0194755_35_415 126
83 3300049822 Ga0501035_0925456 Ga0501035_0925456_181_561 126
84 3300049823 Ga0501044_0146763 Ga0501044_0146763_1542_1925 126
85 3300060353 Ga0501082_0467469 Ga0501082_0467469_230_610 126
86 3300061734 Ga0530510_0069644 Ga0530510_0069644_1026_1406 126
87 3300005355 Ga0070671_100637692 Ga0070671_1006376923 127
88 3300005435 Ga0070714_101810837 Ga0070714_1018108372 127
89 3300005436 Ga0070713_100905077 Ga0070713_1009050772 127
90 3300005543 Ga0070672_102137971 Ga0070672_1021379711 127
91 3300005548 Ga0070665_100213492 Ga0070665_1002134922 127
92 3300005614 Ga0068856_100028444 Ga0068856_1000284444 127
93 3300006237 Ga0097621_100571370 Ga0097621_1005713702 127
94 3300006358 Ga0068871_100238253 Ga0068871_1002382533 127
95 3300009174 Ga0105241_10129843 Ga0105241_101298435 127
96 3300009177 Ga0105248_10793195 Ga0105248_107931951 127
97 3300009545 Ga0105237_12659354 Ga0105237_126593541 127
98 3300013100 Ga0157373_10156718 Ga0157373_101567182 127
99 3300013104 Ga0157370_10375260 Ga0157370_103752603 127
100 3300013105 Ga0157369_10061131 Ga0157369_100611312 127
101 3300013296 Ga0157374_10294244 Ga0157374_102942441 127
102 3300013307 Ga0157372_10945741 Ga0157372_109457412 127
103 3300014325 Ga0163163_10616978 Ga0163163_106169782 127
104 3300025911 Ga0207654_10231518 Ga0207654_102315182 127
105 3300025929 Ga0207664_11541236 Ga0207664_115412362 127
106 3300025945 Ga0207679_10382865 Ga0207679_103828652 127
107 3300025981 Ga0207640_10810139 Ga0207640_108101391 127
108 3300026116 Ga0207674_10739652 Ga0207674_107396522 127
109 3300046472 Ga0495580_0219505 Ga0495580_0219505_889_1272 127
110 3300048915 Ga0496112_1035972 Ga0496112_1035972_126_509 127
111 3300049577 Ga0501041_0336406 Ga0501041_0336406_285_668 127
112 3300049658 Ga0501211_042580 Ga0501211_042580_67_450 127
113 3300049675 Ga0501243_035284 Ga0501243_035284_147_530 127
114 3300049779 Ga0501283_015371 Ga0501283_015371_613_996 127
115 3300005329 Ga0070683_100016955 Ga0070683_1000169555 128
116 3300005458 Ga0070681_10390168 Ga0070681_103901681 128
117 3300005468 Ga0070707_100794064 Ga0070707_1007940641 128
118 3300005530 Ga0070679_101033024 Ga0070679_1010330241 128
119 3300005546 Ga0070696_101571836 Ga0070696_1015718361 128
120 3300005548 Ga0070665_100208871 Ga0070665_1002088713 128
121 3300005981 Ga0081538_10022502 Ga0081538_100225023 128
122 3300005981 Ga0081538_10156382 Ga0081538_101563822 128
123 3300006844 Ga0075428_100121780 Ga0075428_1001217801 128
124 3300006844 Ga0075428_102366202 Ga0075428_1023662022 128
125 3300009101 Ga0105247_10876897 Ga0105247_108768972 128
126 3300009147 Ga0114129_10206617 Ga0114129_102066174 128
127 3300009545 Ga0105237_10181947 Ga0105237_101819473 128
128 3300021358 Ga0213873_10011030 Ga0213873_100110304 128
129 3300025926 Ga0207659_11599228 Ga0207659_115992282 128
130 3300025929 Ga0207664_11165208 Ga0207664_111652081 128
131 3300028379 Ga0268266_10006545 Ga0268266_100065459 128
132 3300028379 Ga0268266_11454270 Ga0268266_114542702 128
133 3300031249 Ga0265339_10418178 Ga0265339_104181782 128
134 3300031595 Ga0265313_10246953 Ga0265313_102469532 128
135 3300031712 Ga0265342_10392871 Ga0265342_103928712 128
136 3300031727 Ga0316576_10069939 Ga0316576_100699394 128
137 3300031727 Ga0316576_10578874 Ga0316576_105788742 128
138 3300031852 Ga0307410_10093194 Ga0307410_100931943 128
139 3300031901 Ga0307406_10544191 Ga0307406_105441912 128
140 3300032005 Ga0307411_10545000 Ga0307411_105450002 128
141 3300036457 Ga0265778_007330 Ga0265778_007330_218_604 128
142 3300036712 Ga0316584_0449428 Ga0316584_0449428_436_822 128
143 3300039438 Ga0436360_0705347 Ga0436360_0705347_431_817 128
144 3300039447 Ga0436361_0115901 Ga0436361_0115901_777_1163 128
145 3300039450 Ga0436363_1702221 Ga0436363_1702221_2756_3142 128
146 3300041498 Ga0451841_1204271 Ga0451841_1204271_269_655 128
147 3300041503 Ga0451847_0609633 Ga0451847_0609633_437_823 128
148 3300044694 Ga0466963_0004426 Ga0466963_0004426_3943_4332 128
149 3300044842 Ga0466957_0026705 Ga0466957_0026705_1825_2214 128
150 3300046616 Ga0495668_0000292 Ga0495668_0000292_13242_13628 128
151 3300049572 Ga0501036_0714865 Ga0501036_0714865_216_602 128
152 3300049579 Ga0501043_0533287 Ga0501043_0533287_372_758 128
153 3300049590 Ga0501074_0304627 Ga0501074_0304627_265_651 128
154 3300049591 Ga0501075_1090611 Ga0501075_1090611_73_459 128
155 3300049593 Ga0501077_0794165 Ga0501077_0794165_207_593 128
156 3300049686 Ga0501257_070022 Ga0501257_070022_365_751 128
157 3300049741 Ga0501079_0227485 Ga0501079_0227485_21_407 128
158 3300006914 Ga0075436_100359021 Ga0075436_1003590213 129
159 3300031727 Ga0316576_10063077 Ga0316576_100630773 129
160 3300031728 Ga0316578_10082132 Ga0316578_100821321 129
161 3300036647 Ga0316582_0541667 Ga0316582_0541667_50_439 129
162 3300039438 Ga0436360_0516032 Ga0436360_0516032_497_886 129
163 3300039450 Ga0436363_1468001 Ga0436363_1468001_245_634 129
164 3300049741 Ga0501079_0635904 Ga0501079_0635904_168_557 129
165 3300050514 nmdc:mga08x19_796216_c1 nmdc:mga08x19_796216_c1_242_631 129
166 3300054114 Ga0501084_0316849 Ga0501084_0316849_898_1287 129
167 3300003322 rootL2_10226482 rootL2_102264823 131
168 3300005338 Ga0068868_100601149 Ga0068868_1006011491 131
169 3300005841 Ga0068863_100138217 Ga0068863_1001382172 131
170 3300009093 Ga0105240_11003597 Ga0105240_110035971 131
171 3300013296 Ga0157374_10100539 Ga0157374_101005392 131
172 3300013306 Ga0163162_10922088 Ga0163162_109220882 131
173 3300014325 Ga0163163_10044348 Ga0163163_100443484 131
174 3300049521 Ga0501298_079717 Ga0501298_079717_265_663 131

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

12

133

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ecw-assembly1.cif.gz_B structure of the shigella flexneri vapc mutant d7a 0.7711 1 126
3zvk-assembly1.cif.gz_D crystal structure of vapbc2 from rickettsia felis bound to a dna fragment from their promoter 0.7706 1 129
3zvk-assembly1.cif.gz_B crystal structure of vapbc2 from rickettsia felis bound to a dna fragment from their promoter 0.7643 1 127
3zvk-assembly1.cif.gz_D crystal structure of vapbc2 from rickettsia felis bound to a dna fragment from their promoter 0.7551 1 129
6sd6-assembly1.cif.gz_C structure of vapbc from shigella sonnei 0.7504 1 128
ID Description Score Start End Superfamily
af_P71623_4_126_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8427 4 120 3.40.50.1010
af_P71623_4_126_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7873 4 120 3.40.50.1010
5ecwB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7711 1 126 3.40.50.1010
3zvkB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7643 1 127 3.40.50.1010
af_O53779_1_126_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.746 4 121 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A4V2ESD0-F1-model_v4 PIN domain nuclease of toxin-antitoxin system 0.9962 1 130 GO:0004518
AF-A0A6A0IGQ3-F1-model_v4 Type II toxin-antitoxin system VapC family toxin 0.9953 1 130
AF-A0A6N7H3X3-F1-model_v4 PIN domain-containing protein 0.9946 1 128 GO:0004518
AF-A0A2V9R6P7-F1-model_v4 PIN domain nuclease 0.9937 1 131
AF-A0A2V9M2I3-F1-model_v4 PIN domain nuclease 0.9918 1 128

Feature Viewer

pLDDT pTM Quality
96.37 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map