F264221

General Info

Members Datasets Scaffolds Average Seq Length
174 110 348 151

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100625262|Ga0068863_1006252621
Length 170
Sequence MWEASATTPEGVIMKVKMLVSACLLASAVTGPVLAQTTPATGAMAQATAPTLYKRLGGYDALAAVTDDFLQRLISEQQFARFFGGHSTDSLKKIRQLIVDQLCAATGGPCVYIGRDMKTTHAGLGIMNGDWDMMVKHLNATFEKFNVPAKERDDVLTALGPLKKDIVDKP

Samples

Sample ID Description Type Environment
1 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
61 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
88 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
89 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
90 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
91 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
95 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
96 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
97 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
98 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
99 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
100 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
101 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
102 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
103 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
104 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
105 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
106 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
107 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
108 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
109 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
110 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.57
Rhizosphere 96.55
Stem 0
Stem Tuber 0
Unclassified 24.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068863_100625262 3300005841 Bacteria 1067
2 Ga0065715_10127870 3300005293 Bacteria 2077
3 Ga0065715_10224688 3300005293 Bacteria 1257
4 Ga0070690_100186889 3300005330 Bacteria 1434
5 Ga0068869_100344024 3300005334 Bacteria 1214
6 Ga0068869_100988509 3300005334 Bacteria 732
7 Ga0070680_100462948 3300005336 Bacteria 1083
8 Ga0070687_100021181 3300005343 Unclassified 3051
9 Ga0070668_100029635 3300005347 Bacteria 4157
10 Ga0070671_101273254 3300005355 Bacteria 648
11 Ga0070673_101681759 3300005364 Unclassified 600
12 Ga0070703_10000187 3300005406 Bacteria 30058
13 Ga0070709_10000013 3300005434 Bacteria 162177
14 Ga0070713_100156902 3300005436 Unclassified 2029
15 Ga0070710_10158836 3300005437 Bacteria 1400
16 Ga0070701_10311531 3300005438 Unclassified 971
17 Ga0070711_100000173 3300005439 Bacteria 34482
18 Ga0070705_100000257 3300005440 Bacteria 31587
19 Ga0070694_100217421 3300005444 Unclassified 1432
20 Ga0070694_101098741 3300005444 Unclassified 663
21 Ga0070708_100104278 3300005445 Bacteria 2600
22 Ga0070708_100193238 3300005445 Unclassified 1904
23 Ga0070685_10014725 3300005466 Bacteria 4146
24 Ga0070706_100000070 3300005467 Bacteria 118491
25 Ga0070706_100044076 3300005467 Bacteria 4121
26 Ga0070706_100163843 3300005467 Unclassified 2076
27 Ga0070706_100246513 3300005467 Bacteria 1668
28 Ga0070707_100072445 3300005468 Bacteria 3320
29 Ga0070707_100170725 3300005468 Bacteria 2119
30 Ga0070707_100817107 3300005468 Unclassified 896
31 Ga0070707_101005311 3300005468 Unclassified 799
32 Ga0070698_100054017 3300005471 Bacteria 4080
33 Ga0070699_100000369 3300005518 Bacteria 44023
34 Ga0070699_100171744 3300005518 Unclassified 1921
35 Ga0070699_100485005 3300005518 Unclassified 1122
36 Ga0070699_101342356 3300005518 Bacteria 656
37 Ga0070697_100143089 3300005536 Unclassified 2012
38 Ga0068853_100086631 3300005539 Bacteria 2747
39 Ga0068853_100575718 3300005539 Bacteria 1068
40 Ga0070686_101691317 3300005544 Bacteria 537
41 Ga0070695_100491128 3300005545 Bacteria 948
42 Ga0070696_100000080 3300005546 Bacteria 47606
43 Ga0070696_100030773 3300005546 Unclassified 3676
44 Ga0070704_100088718 3300005549 Unclassified 2298
45 Ga0070704_100157143 3300005549 Bacteria 1795
46 Ga0070704_100185447 3300005549 Bacteria 1668
47 Ga0070704_100407175 3300005549 Unclassified 1162
48 Ga0070704_100851847 3300005549 Bacteria 817
49 Ga0068857_100055061 3300005577 Bacteria 3530
50 Ga0068856_100877625 3300005614 Bacteria 916
51 Ga0070702_100245675 3300005615 Unclassified 1210
52 Ga0068852_100009738 3300005616 Bacteria 7143
53 Ga0068852_100209500 3300005616 Bacteria 1848
54 Ga0068859_100625269 3300005617 Bacteria 1169
55 Ga0068858_101045116 3300005842 Bacteria 801
56 Ga0068862_101111239 3300005844 Unclassified 786
57 Ga0081455_11027984 3300005937 Bacteria 510
58 Ga0081539_10013053 3300005985 Bacteria 6302
59 Ga0070715_10150970 3300006163 Bacteria 1138
60 Ga0070712_100113687 3300006175 Bacteria 2025
61 Ga0075428_100009651 3300006844 Bacteria 10718
62 Ga0075428_100683269 3300006844 Bacteria 1094
63 Ga0075431_100006358 3300006847 Bacteria 11730
64 Ga0075433_10140673 3300006852 Unclassified 2145
65 Ga0075433_10412569 3300006852 Bacteria 1191
66 Ga0075433_10594298 3300006852 Unclassified 972
67 Ga0075433_10958448 3300006852 Unclassified 746
68 Ga0075434_100116114 3300006871 Unclassified 2690
69 Ga0075434_100539756 3300006871 Unclassified 1186
70 Ga0075429_100140085 3300006880 Bacteria 2117
71 Ga0075429_100205189 3300006880 Bacteria 1727
72 Ga0075436_100004141 3300006914 Bacteria 9950
73 Ga0075436_100290622 3300006914 Bacteria 1170
74 Ga0075436_100305680 3300006914 Bacteria 1140
75 Ga0075436_100729153 3300006914 Bacteria 735
76 Ga0097620_100625262 3300006931 Bacteria 1169
77 Ga0075435_100831823 3300007076 Unclassified 804
78 Ga0075435_100860198 3300007076 Unclassified 790
79 Ga0105240_10000400 3300009093 Bacteria 80751
80 Ga0111539_10119062 3300009094 Bacteria 3095
81 Ga0111539_11174765 3300009094 Unclassified 891
82 Ga0105245_12448076 3300009098 Bacteria 575
83 Ga0105247_10023550 3300009101 Bacteria 3709
84 Ga0114129_10037773 3300009147 Bacteria 6815
85 Ga0114129_10043298 3300009147 Bacteria 6334
86 Ga0114129_10273177 3300009147 Unclassified 2261
87 Ga0114129_10317452 3300009147 Bacteria 2072
88 Ga0114129_10386934 3300009147 Bacteria 1846
89 Ga0114129_10700078 3300009147 Bacteria 1302
90 Ga0105241_10636393 3300009174 Unclassified 967
91 Ga0105237_10347180 3300009545 Bacteria 1488
92 Ga0105238_10016485 3300009551 Bacteria 7479
93 Ga0105239_10029310 3300010375 Bacteria 6052
94 Ga0157369_10006076 3300013105 Bacteria 14013
95 Ga0157369_10028652 3300013105 Bacteria 6162
96 Ga0157369_10419562 3300013105 Unclassified 1387
97 Ga0157377_10000953 3300014745 Bacteria 12112
98 Ga0213874_10082147 3300021377 Bacteria 1046
99 Ga0207653_10000013 3300025885 Bacteria 159236
100 Ga0207710_10017135 3300025900 Bacteria 3071
101 Ga0207699_10000007 3300025906 Bacteria 405928
102 Ga0207684_10000037 3300025910 Bacteria 284224
103 Ga0207684_10213413 3300025910 Bacteria 1665
104 Ga0207684_10434781 3300025910 Bacteria 1127
105 Ga0207654_10027232 3300025911 Bacteria 3105
106 Ga0207654_10237905 3300025911 Unclassified 1215
107 Ga0207695_10000004 3300025913 Bacteria 1288665
108 Ga0207695_10866842 3300025913 Unclassified 783
109 Ga0207671_10050185 3300025914 Bacteria 3090
110 Ga0207693_10470035 3300025915 Bacteria 982
111 Ga0207663_10000004 3300025916 Bacteria 294638
112 Ga0207662_10074333 3300025918 Unclassified 2063
113 Ga0207649_10040681 3300025920 Bacteria 2827
114 Ga0207649_11017595 3300025920 Bacteria 652
115 Ga0207646_10188206 3300025922 Bacteria 1864
116 Ga0207646_10242457 3300025922 Bacteria 1628
117 Ga0207694_10000010 3300025924 Bacteria 439722
118 Ga0207650_11298963 3300025925 Bacteria 619
119 Ga0207700_10297412 3300025928 Unclassified 1393
120 Ga0207670_10071220 3300025936 Bacteria 2404
121 Ga0207665_11442595 3300025939 Bacteria 548
122 Ga0207689_10058902 3300025942 Bacteria 3159
123 Ga0207689_10348158 3300025942 Bacteria 1231
124 Ga0207667_10000200 3300025949 Bacteria 86644
125 Ga0207639_10331433 3300026041 Bacteria 1354
126 Ga0207674_10196950 3300026116 Unclassified 1964
127 Ga0207675_101474373 3300026118 Bacteria 701
128 Ga0207698_10552027 3300026142 Bacteria 1129
129 Ga0207428_10059828 3300027907 Bacteria 3019
130 Ga0207428_10111667 3300027907 Bacteria 2103
131 Ga0268265_10777775 3300028380 Unclassified 931
132 Ga0268264_12536469 3300028381 Bacteria 518
133 Ga0307513_10741185 3300031456 Unclassified 688
134 Ga0307516_10004426 3300031730 Bacteria 17354
135 Ga0373943_0072308 3300035170 Bacteria 1749
136 Ga0373946_0139429 3300035171 Bacteria 1123
137 Ga0373946_0295183 3300035171 Unclassified 800
138 Ga0373935_0446700 3300035692 Bacteria 934
139 Ga0373927_0799489 3300035695 Bacteria 623
140 Ga0373947_0325477 3300035725 Bacteria 1028
141 Ga0436365_0175121 3300039437 Bacteria 1978
142 Ga0436365_1115504 3300039437 Bacteria 2409
143 Ga0436362_0148068 3300039453 Bacteria 2161
144 Ga0436362_1017252 3300039453 Bacteria 1476
145 Ga0453683_0060804 3300044673 Bacteria 2362
146 Ga0495586_0073612 3300046535 Bacteria 1869
147 Ga0495647_0120896 3300046681 Bacteria 1101
148 Ga0496109_0668472 3300048912 Bacteria 976
149 Ga0495682_0009492 3300049460 Bacteria 3795
150 Ga0501067_0256639 3300049583 Archaea 973
151 Ga0501069_0785283 3300049585 Bacteria 577
152 nmdc:mga05p37_210196_c1 3300050507 Bacteria 2353
153 nmdc:mga05p37_456637_c1 3300050507 Bacteria 1477
154 nmdc:mga05p37_466390_c1 3300050507 Bacteria 1458
155 nmdc:mga05p37_595471_c1 3300050507 Bacteria 1249
156 nmdc:mga09592_126269_c1 3300050508 Bacteria 2199
157 nmdc:mga09592_181855_c1 3300050508 Unclassified 1819
158 nmdc:mga09592_197356_c1 3300050508 Bacteria 1742
159 nmdc:mga06r32_21029_c1 3300050510 Bacteria 6019
160 nmdc:mga08y16_303674_c1 3300050511 Bacteria 1645
161 nmdc:mga08y16_80787_c1 3300050511 Bacteria 3390
162 nmdc:mga0n895_163703_c1 3300050512 Bacteria 2256
163 nmdc:mga0n895_235790_c1 3300050512 Bacteria 1857
164 nmdc:mga0rr50_141389_c1 3300050513 Bacteria 1936
165 nmdc:mga0rr50_583750_c1 3300050513 Unclassified 952
166 nmdc:mga0rr50_761002_c1 3300050513 Unclassified 827
167 nmdc:mga08x19_101_c1 3300050514 Bacteria 75974
168 nmdc:mga08x19_273611_c1 3300050514 Bacteria 1169
169 nmdc:mga08x19_806086_c1 3300050514 Unclassified 667
170 nmdc:mga08x19_82551_c1 3300050514 Bacteria 2112
171 nmdc:mga08x19_892706_c1 3300050514 Bacteria 631
172 nmdc:mga08x19_913805_c1 3300050514 Unclassified 623
173 nmdc:mga0a205_381813_c2 3300050515 Unclassified 971
174 nmdc:mga0a205_400727_c1 3300050515 Bacteria 1236
175 Ga0068863_100625262
176 Ga0065715_10127870
177 Ga0065715_10224688
178 Ga0070690_100186889
179 Ga0068869_100344024
180 Ga0068869_100988509
181 Ga0070680_100462948
182 Ga0070687_100021181
183 Ga0070668_100029635
184 Ga0070671_101273254
185 Ga0070673_101681759
186 Ga0070703_10000187
187 Ga0070709_10000013
188 Ga0070713_100156902
189 Ga0070710_10158836
190 Ga0070701_10311531
191 Ga0070711_100000173
192 Ga0070705_100000257
193 Ga0070694_100217421
194 Ga0070694_101098741
195 Ga0070708_100104278
196 Ga0070708_100193238
197 Ga0070685_10014725
198 Ga0070706_100000070
199 Ga0070706_100044076
200 Ga0070706_100163843
201 Ga0070706_100246513
202 Ga0070707_100072445
203 Ga0070707_100170725
204 Ga0070707_100817107
205 Ga0070707_101005311
206 Ga0070698_100054017
207 Ga0070699_100000369
208 Ga0070699_100171744
209 Ga0070699_100485005
210 Ga0070699_101342356
211 Ga0070697_100143089
212 Ga0068853_100086631
213 Ga0068853_100575718
214 Ga0070686_101691317
215 Ga0070695_100491128
216 Ga0070696_100000080
217 Ga0070696_100030773
218 Ga0070704_100088718
219 Ga0070704_100157143
220 Ga0070704_100185447
221 Ga0070704_100407175
222 Ga0070704_100851847
223 Ga0068857_100055061
224 Ga0068856_100877625
225 Ga0070702_100245675
226 Ga0068852_100009738
227 Ga0068852_100209500
228 Ga0068859_100625269
229 Ga0068858_101045116
230 Ga0068862_101111239
231 Ga0081455_11027984
232 Ga0081539_10013053
233 Ga0070715_10150970
234 Ga0070712_100113687
235 Ga0075428_100009651
236 Ga0075428_100683269
237 Ga0075431_100006358
238 Ga0075433_10140673
239 Ga0075433_10412569
240 Ga0075433_10594298
241 Ga0075433_10958448
242 Ga0075434_100116114
243 Ga0075434_100539756
244 Ga0075429_100140085
245 Ga0075429_100205189
246 Ga0075436_100004141
247 Ga0075436_100290622
248 Ga0075436_100305680
249 Ga0075436_100729153
250 Ga0097620_100625262
251 Ga0075435_100831823
252 Ga0075435_100860198
253 Ga0105240_10000400
254 Ga0111539_10119062
255 Ga0111539_11174765
256 Ga0105245_12448076
257 Ga0105247_10023550
258 Ga0114129_10037773
259 Ga0114129_10043298
260 Ga0114129_10273177
261 Ga0114129_10317452
262 Ga0114129_10386934
263 Ga0114129_10700078
264 Ga0105241_10636393
265 Ga0105237_10347180
266 Ga0105238_10016485
267 Ga0105239_10029310
268 Ga0157369_10006076
269 Ga0157369_10028652
270 Ga0157369_10419562
271 Ga0157377_10000953
272 Ga0213874_10082147
273 Ga0207653_10000013
274 Ga0207710_10017135
275 Ga0207699_10000007
276 Ga0207684_10000037
277 Ga0207684_10213413
278 Ga0207684_10434781
279 Ga0207654_10027232
280 Ga0207654_10237905
281 Ga0207695_10000004
282 Ga0207695_10866842
283 Ga0207671_10050185
284 Ga0207693_10470035
285 Ga0207663_10000004
286 Ga0207662_10074333
287 Ga0207649_10040681
288 Ga0207649_11017595
289 Ga0207646_10188206
290 Ga0207646_10242457
291 Ga0207694_10000010
292 Ga0207650_11298963
293 Ga0207700_10297412
294 Ga0207670_10071220
295 Ga0207665_11442595
296 Ga0207689_10058902
297 Ga0207689_10348158
298 Ga0207667_10000200
299 Ga0207639_10331433
300 Ga0207674_10196950
301 Ga0207675_101474373
302 Ga0207698_10552027
303 Ga0207428_10059828
304 Ga0207428_10111667
305 Ga0268265_10777775
306 Ga0268264_12536469
307 Ga0307513_10741185
308 Ga0307516_10004426
309 Ga0373943_0072308
310 Ga0373946_0139429
311 Ga0373946_0295183
312 Ga0373935_0446700
313 Ga0373927_0799489
314 Ga0373947_0325477
315 Ga0436365_0175121
316 Ga0436365_1115504
317 Ga0436362_0148068
318 Ga0436362_1017252
319 Ga0453683_0060804
320 Ga0495586_0073612
321 Ga0495647_0120896
322 Ga0496109_0668472
323 Ga0495682_0009492
324 Ga0501067_0256639
325 Ga0501069_0785283
326 nmdc:mga05p37_210196_c1
327 nmdc:mga05p37_456637_c1
328 nmdc:mga05p37_466390_c1
329 nmdc:mga05p37_595471_c1
330 nmdc:mga09592_126269_c1
331 nmdc:mga09592_181855_c1
332 nmdc:mga09592_197356_c1
333 nmdc:mga06r32_21029_c1
334 nmdc:mga08y16_303674_c1
335 nmdc:mga08y16_80787_c1
336 nmdc:mga0n895_163703_c1
337 nmdc:mga0n895_235790_c1
338 nmdc:mga0rr50_141389_c1
339 nmdc:mga0rr50_583750_c1
340 nmdc:mga0rr50_761002_c1
341 nmdc:mga08x19_101_c1
342 nmdc:mga08x19_273611_c1
343 nmdc:mga08x19_806086_c1
344 nmdc:mga08x19_82551_c1
345 nmdc:mga08x19_892706_c1
346 nmdc:mga08x19_913805_c1
347 nmdc:mga0a205_381813_c2
348 nmdc:mga0a205_400727_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01152

Bac_globin

Bacterial-like globin

51

168

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gl3-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis trhbn, tyrb10phe glne11val mutant 0.971 27 145
1idr-assembly1.cif.gz_A crystal structure of the truncated-hemoglobin-n from mycobacterium tuberculosis 0.965 28 145
2gkn-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis trhbn, glne11val mutant 0.9641 27 145
2gln-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis trhbn, glne11ala mutant 0.9596 28 146
1s56-assembly2.cif.gz_B "crystal structure of ""truncated"" hemoglobin n (hbn) from mycobacterium tuberculosis, soaked with xe atoms" 0.9574 28 148
ID Description Score Start End Superfamily
1uvyA00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.9512 28 146 1.10.490.10
3aq5A00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.9464 27 146 1.10.490.10
1uvyA00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.9434 28 146 1.10.490.10
3aq5A00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.9388 27 146 1.10.490.10
5ab8A00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.9351 27 145 1.10.490.10
ID Description Score Start End GO Terms
AF-K9WZP6-F1-model_v4 Truncated hemoglobin 0.9946 27 146 GO:0015671
GO:0019825
GO:0020037
GO:0046872
AF-A0A849MFJ6-F1-model_v4 Group 1 truncated hemoglobin 0.9932 30 146 GO:0015671
GO:0019825
GO:0020037
GO:0046872
AF-A0A2V8RB65-F1-model_v4 Group 1 truncated hemoglobin 0.9914 26 146 GO:0019825
GO:0020037
GO:0046872
AF-A0A2V9B3V4-F1-model_v4 SnoaL-like domain-containing protein 0.9912 24 146 GO:0019825
GO:0020037
GO:0046872
AF-A0A1G0PFH4-F1-model_v4 Globin 0.9879 43 146 GO:0019825
GO:0020037
GO:0046872

Map